StarFunc result for job id Q2M389

User Input

>input (1173 residues)
MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFN
LDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYG
EGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEK
LKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVE
AKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFP
DNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESIL
SKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLV
ELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKKRVISDKKYSEQRLDVLSAL
VLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQ
CDCCFLYWHRAVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESYEILLDCY
DKEIMEILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPFKVGMKDLALFFSLNPIRFFN
RFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQGL
DVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLG
VTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDIVNFEELVKEE
GLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPL
TLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYILKLLDQYREFDSLHWFQSVREKY
LKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTA
AEENQEKKEKEEETKTSNGDLSDSTVSADPVVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087X256	0.964	0.963	0.000	1174	1.000	0.999	A0A087X256.pdb.gz	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
2	AFDB:E7F4L4	0.962	0.962	0.000	1173	0.847	0.847	E7F4L4.pdb.gz	E7F4L4_DANRE WASH complex subunit 4 OS=Danio rerio OX=7955 GN=si:dkey-23p11.2 PE=1 SV=1
3	AFDB:Q54R74	0.882	0.911	2.276E-77	1135	0.413	0.427	Q54R74.pdb.gz	WASC4_DICDI WASH complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=washc4 PE=1 SV=1
4	AFDB:Q9VXH9	0.751	0.794	1.054E-45	1102	0.263	0.279	Q9VXH9.pdb.gz	WASC4_DROME WASH complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=SWIP PE=1 SV=2
5	AFDB:Q6UK63	0.536	0.484	9.413E-16	1336	0.133	0.117	Q6UK63.pdb.gz	PIRA_DICDI Protein pirA OS=Dictyostelium discoideum OX=44689 GN=pirA PE=1 SV=1
6	PDB:7usdA	0.517	0.513	7.869E-13	1185	0.126	0.125	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
7	PDB:7useB	0.381	0.400	9.913E-12	1099	0.101	0.108	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
8	AFDB:Q8K1X4	0.389	0.398	1.084E-11	1134	0.113	0.117	Q8K1X4.pdb.gz	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
9	AFDB:Q6NNB2	0.086	0.084	1.325E-4	1233	0.113	0.108	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
10	PDB:7jq9A	0.073	0.046	8.730E-4	2427	0.134	0.065	7jq9A.pdb.gz
11	PDB:3wyfC	0.092	0.101	1.092E-3	1040	0.117	0.132	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
12	AFDB:B5X0I6	0.081	0.089	1.609E-3	1091	0.098	0.105	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
13	PDB:3w3zA	0.071	0.079	1.772E-3	1013	0.097	0.113	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
14	PDB:3w3uA	0.055	0.060	1.981E-3	1030	0.096	0.110	3w3uA.pdb.gz
15	PDB:4bujB	0.063	0.060	2.216E-3	1367	0.130	0.111	4bujB.pdb.gz
16	AFDB:F4JN05	0.106	0.084	3.265E-3	1706	0.109	0.075	F4JN05.pdb.gz	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
17	PDB:7mq8LM	0.084	0.062	3.875E-3	2005	0.107	0.063	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3gb8A	0.069	0.074	5.624E-3	958	0.094	0.115	3gb8A.pdb.gz
19	PDB:7qenD	0.068	0.074	5.624E-3	1050	0.113	0.126	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
20	AFDB:Q9U2M1	0.119	0.104	5.926E-3	1499	0.130	0.101	Q9U2M1.pdb.gz	CND1_CAEEL Condensin complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dpy-28 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X256	0.0	2434	1174	1.000	0.999	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
2	E7F4L4	0.0	2110	1173	0.847	0.847	E7F4L4_DANRE WASH complex subunit 4 OS=Danio rerio OX=7955 GN=si:dkey-23p11.2 PE=1 SV=1
3	Q2M389	0.0	2437	1173	1.000	1.000	WASC4_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2
4	Q3UMB9	0.0	2383	1173	0.968	0.968	WASC4_MOUSE WASH complex subunit 4 OS=Mus musculus OX=10090 GN=Washc4 PE=1 SV=2
5	Q54R74	0.0	973	1135	0.419	0.433	WASC4_DICDI WASH complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=washc4 PE=1 SV=1
6	Q9VXH9	1.07e-131	432	1102	0.279	0.297	WASC4_DROME WASH complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=SWIP PE=1 SV=2
7	F4J6T7	1.7	35.4	868	0.025	0.033	XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=XYL2 PE=5 SV=1
8	P35858	2.7	34.7	605	0.018	0.035	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
9	O04647	4.7	33.9	1038	0.014	0.015	PP399_ARATH Pentatricopeptide repeat-containing protein At5g27270 OS=Arabidopsis thaliana OX=3702 GN=EMB976 PE=2 SV=2
10	P40017	4.7	33.9	923	0.036	0.046	YAT2_YEAST Carnitine O-acetyltransferase YAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAT2 PE=1 SV=1
11	Q9JI81	9.3	32.3	333	0.011	0.039	CAT8_MOUSE Cathepsin 8 OS=Mus musculus OX=10090 GN=Cts8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14745 WASH-4_N	1.1e-234	791.9	WASH complex subunit 4, N-terminal
2	PF14746 WASH-7_C	1.9e-69	244.3	WASH complex subunit 7, C-terminal
3	PF14744 WASH-7_mid	1.4e-162	552.3	WASH complex subunit 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003832603.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003820506.1	0.968	WASH complex subunit strumpellin isoform X1
2	9597.XP_003832626.1	0.952	WASH complex subunit CCDC53 isoform X1
3	9597.XP_008957790.1	0.859	WASH complex subunit FAM21A-like
4	9597.XP_008965336.1	0.834	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
5	9597.XP_003805637.1	0.806	Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
6	9597.XP_003826762.1	0.710	Dmx like 1
7	9597.XP_008956791.1	0.620	FK506-binding protein 15 isoform X1
8	9597.XP_003819177.1	0.595	Coiled-coil domain-containing protein 93 isoform X1
9	9597.XP_003830599.1	0.547	Chromosome 16 open reading frame, human C16orf62
10	9597.XP_003807306.1	0.543	Coiled-coil domain containing 22
11	9597.XP_008954620.1	0.538	Zinc finger protein 2 isoform X1
12	9597.XP_003819836.1	0.533	VPS35, retromer complex component
13	9597.XP_003817291.1	0.529	Sorting nexin family member 27
14	9597.XP_003807266.1	0.517	Wiskott-Aldrich syndrome
15	9597.XP_003827897.1	0.514	Family with sequence similarity 214 member A
16	9597.XP_003806815.1	0.513	Survival motor neuron protein
17	9597.XP_003817705.1	0.512	HEAT repeat containing 5B
18	9597.XP_008956145.1	0.506	Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway
19	9597.XP_008958979.1	0.506	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051234	0.995	establishment of localization
GO:0051641	0.995	cellular localization
GO:0016192	0.992	vesicle-mediated transport
GO:0016197	0.984	endosomal transport
GO:0071840	0.871	cellular component organization or biogenesis
GO:0016043	0.848	cellular component organization
GO:0065007	0.802	biological regulation
GO:0050789	0.758	regulation of biological process
GO:0050794	0.657	regulation of cellular process
GO:0006996	0.645	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0012505	0.997	endomembrane system
GO:0031981	0.996	nuclear lumen
GO:0031410	0.995	cytoplasmic vesicle
GO:0005654	0.994	nucleoplasm
GO:0005768	0.987	endosome
GO:0071203	0.965	WASH complex
GO:0005829	0.947	cytosol
GO:0016020	0.878	membrane
GO:0005769	0.370	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]