StarFunc result for job id Q2M3C6

User Input

>input (531 residues)
MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTA
GSQLLSNLDEDYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELL
IDIKLLQFSSAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIIL
SLAPMVASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKLEMEMVIQQYEKAKVI
QDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLEAG
TWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVCMVTTAAIDIH
QPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSS
EPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEH
RVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2M3C6	1.000	1.000	1.383E-73	531	1.000	1.000	Q2M3C6.pdb.gz	TM266_HUMAN Transmembrane protein 266 OS=Homo sapiens OX=9606 GN=TMEM266 PE=1 SV=2
2	PDB:7fhkA	0.202	0.165	1.143E-2	663	0.045	0.036	7fhkA.pdb.gz	Voltage-gating and cytosolic Ca 2+ activation mechanisms of Arabidopsis two-pore channel AtTPC1.
3	PDB:7mixA	0.183	0.083	1.457E-2	1326	0.058	0.023	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
4	PDB:7eebB	0.193	0.337	1.548E-2	281	0.055	0.103	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
5	PDB:7we4A	0.181	0.096	1.856E-2	1122	0.055	0.026	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
6	AFDB:Q8SX60	0.121	0.139	2.659E-2	435	0.102	0.124	Q8SX60.pdb.gz	Q8SX60_DROME LD42159p OS=Drosophila melanogaster OX=7227 GN=ReepA PE=1 SV=1
7	AFDB:Q9Y091	0.140	0.139	4.063E-2	536	0.137	0.136	Q9Y091.pdb.gz	FL2D_DROME Pre-mRNA-splicing regulator female-lethal(2)D OS=Drosophila melanogaster OX=7227 GN=fl(2)d PE=1 SV=2
8	PDB:7vfsA	0.184	0.086	4.606E-2	1266	0.049	0.021	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
9	AFDB:Q99LJ0	0.087	0.075	5.177E-2	638	0.143	0.119	Q99LJ0.pdb.gz	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
10	AFDB:P35712	0.125	0.084	5.501E-2	828	0.158	0.101	P35712.pdb.gz	SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens OX=9606 GN=SOX6 PE=1 SV=3
11	AFDB:F4J1A4	0.093	0.104	5.844E-2	468	0.136	0.154	F4J1A4.pdb.gz	F4J1A4_ARATH IQ-domain 1 OS=Arabidopsis thaliana OX=3702 GN=IQD1 PE=1 SV=1
12	PDB:7eebA	0.192	0.359	6.235E-2	258	0.045	0.093	7eebA.pdb.gz	Structure of a mammalian sperm cation channel complex.
13	AFDB:Q38BU5	0.135	0.097	6.597E-2	785	0.151	0.102	Q38BU5.pdb.gz	Q38BU5_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4550 PE=4 SV=1
14	PDB:7w9lA	0.186	0.078	8.442E-2	1420	0.056	0.021	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
15	PDB:6nq0A	0.200	0.175	1.290E-1	621	0.068	0.058	6nq0A.pdb.gz	Structural mechanisms of phospholipid activation of the human TPC2 channel.
16	PDB:6j8eA	0.201	0.099	1.371E-1	1139	0.040	0.018	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
17	PDB:5vb2D	0.174	0.312	1.456E-1	268	0.047	0.093	5vb2D.pdb.gz
18	AFDB:Q6PDM4	0.125	0.117	1.739E-1	574	0.151	0.139	Q6PDM4.pdb.gz	IHO1_MOUSE Interactor of HORMAD1 protein 1 OS=Mus musculus OX=10090 GN=Iho1 PE=1 SV=3
19	AFDB:J3KRB9	0.140	0.132	1.848E-1	574	0.166	0.153	J3KRB9.pdb.gz	J3KRB9_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=2
20	AFDB:Q68UI8	0.114	0.104	2.086E-1	603	0.122	0.108	Q68UI8.pdb.gz	CCD61_CHLRE Variable flagella 3 OS=Chlamydomonas reinhardtii OX=3055 GN=VFL3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2M3C6	0.0	1079	531	1.000	1.000	TM266_HUMAN Transmembrane protein 266 OS=Homo sapiens OX=9606 GN=TMEM266 PE=1 SV=2
2	Q6DHQ1	3.43e-12	68.6	235	0.092	0.209	HVCN1_DANRE Voltage-gated hydrogen channel 1 OS=Danio rerio OX=7955 GN=hvcn1 PE=2 SV=1
3	Q96D96	9.26e-08	55.8	273	0.081	0.158	HVCN1_HUMAN Voltage-gated hydrogen channel 1 OS=Homo sapiens OX=9606 GN=HVCN1 PE=1 SV=1
4	D3ZIU8	2.45e-06	51.6	273	0.073	0.143	D3ZIU8_RAT Voltage-gated hydrogen channel 1 OS=Rattus norvegicus OX=10116 GN=Hvcn1 PE=3 SV=3
5	Q3U2S8	7.60e-06	50.1	269	0.072	0.141	HVCN1_MOUSE Voltage-gated hydrogen channel 1 OS=Mus musculus OX=10090 GN=Hvcn1 PE=1 SV=2
6	Q05152	1.10e-05	50.8	2339	0.053	0.012	CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus OX=9986 GN=CACNA1B PE=1 SV=1
7	O55017	2.55e-05	49.7	2327	0.051	0.012	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
8	Q02294	3.15e-05	49.3	2336	0.051	0.012	CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
9	Q00975	1.64e-04	47.0	2339	0.047	0.011	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
10	O89089	3.66e-04	45.8	2333	0.045	0.010	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
11	O00555	6.25e-04	45.4	2506	0.053	0.011	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
12	Q9NS89	7.03e-04	45.1	2472	0.053	0.011	Q9NS89_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=CACNA1A PE=2 SV=1
13	P97445	7.44e-04	45.1	2368	0.053	0.012	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
14	P54282	0.002	43.9	2212	0.053	0.013	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
15	A8JUY8	0.003	42.7	3205	0.053	0.009	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
16	M9NDQ0	0.003	42.7	3200	0.053	0.009	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
17	M9NGR9	0.003	42.7	3180	0.053	0.009	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
18	M9PGH9	0.003	42.7	3218	0.053	0.009	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
19	P27884	0.003	42.7	2424	0.051	0.011	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
20	Q01118	0.003	42.7	1682	0.056	0.018	SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens OX=9606 GN=SCN7A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06738 ThrE	27	15.6	Putative threonine/serine exporter
2	PF05887 Trypan_PARP	2.1e+02	13.3	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302843	0.726	DnaJ heat shock protein family member C18
2	9606.ENSP00000247843	0.707	YEATS domain-containing protein 4
3	9606.ENSP00000378294	0.706	Nucleotide exchange factor SIL1
4	9606.ENSP00000274711	0.705	Leucine-rich repeat transmembrane neuronal protein 2
5	9606.ENSP00000452762	0.643	Electron transfer flavoprotein subunit alpha, mitochondrial
6	9606.ENSP00000414920	0.639	Spermatogenesis-associated protein 24
7	9606.ENSP00000378275	0.575	Polyadenylate-binding protein-interacting protein 2
8	9606.ENSP00000383089	0.561	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
9	9606.ENSP00000484403	0.515	Putative tyrosine-protein phosphatase TPTE
10	9606.ENSP00000290759	0.514	Insulin gene enhancer protein ISL-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0022857	0.570	transmembrane transporter activity
GO:0015267	0.538	channel activity
GO:0015075	0.495	monoatomic ion transmembrane transporter activity
GO:0005216	0.460	monoatomic ion channel activity
GO:0005261	0.406	monoatomic cation channel activity
GO:0015318	0.341	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.330	inorganic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.971	biological regulation
GO:0050789	0.940	regulation of biological process
GO:0050794	0.855	regulation of cellular process
GO:0051234	0.588	establishment of localization
GO:0006810	0.486	transport
GO:0050896	0.470	response to stimulus
GO:0019222	0.373	regulation of metabolic process
GO:0032501	0.341	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	0.999	cytosol
GO:0097447	0.990	dendritic tree
GO:0030425	0.984	dendrite
GO:0043231	0.846	intracellular membrane-bounded organelle
GO:0012505	0.322	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]