StarFunc result for job id Q2M3C7

User Input

>input (1700 residues)
MDGNSLLSVPSNLESSRMYDVLEPQQGRGCGSSGSGPGNSITACKKVLRSNSLLESTDYW
LQNQRMPCQIGFVEDKSENCASVCFVNLDVNKDECSTEHLQQKLVNVSPDLPKLISSMNV
QQPKENEIVVLSGLASGNLQADFEVSQCPWLPDICLVQCARGNRPNSTNCIIFEINKFLI
GLELVQERQLHLETNILKLEDDTNCSLSSIEEDFLTASEHLEEESEVDESRNDYENINVS
ANVLESKQLKGATQVEWNCNKEKWLYALEDKYINKYPTPLIKTERSPENLTKNTALQSLD
PSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMDKDVPSACAVA
EQRSNLNPGDHEDTRNALPPRQDGEVTTGKYATNLAESVLQDAFIRLSQSQSTLPQESAV
SVSVGSSLLPSCYSTKDTVVSRSWNELPKIVVVQSPDGSDAAPQPGISSWPEMEVSVETS
SILSGENSSRQPQSALEVALACAATVIGTISSPQATERLKMEQVVSNFPPGSSGALQTQA
PQGLKEPSINEYSFPSALCGMTQVASAVAVCGLGEREEVTCSVAPSGSLPPAAEASEAMP
PLCGLASMELGKEAIAKGLLKEAALVLTRPNTYSSIGDFLDSMNRRIMETASKSQTLCSE
NVVRNELAHTLSNVILRHSIDEVHHKNMIIDPNDNRHSSEILDTLMESTNQLLLDVICFT
FKKMSHIVRLGECPAVLSKETIRRRETEPSCQPSDPGASQAWTKATESSSSSPLSNSHNT
SLVINNLVDGMYSKQDKGGVRPGLFKNPTLQSQLSRSHRVPDSSTATTSSKEIYLKGIAG
EDTKSPHHSENECRASSEGQRSPTVSQSRSGSQEAEESIHPNTQEKYNCATSRINEVQVN
LSLLGDDLLLPAQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFC
AWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHPELKEKLMNR
VVDESMNLEDVPDSVNLFANEVAAKIMNLTEFSMVDGMWQAQGYPRNRLLSGDRWSRLKA
SSCESIPEEDSEARAYVNSLGLMSTLSQPVSRASSVSKQSSCESITDEFSRFMVNQMENE
GRGFELLLDYYAGKNASSILNSAMQQACRKSDHLSVRPSCPSKQSSTESITEEFYRYMLR
DIERDSRESASSRRSSQDWTAGLLSPSLRSPVCHRQSSMPDSRSPCSRLTVNVPIKANSL
DGFAQNCPQDFLSVQPVSSASSSGLCKSDSCLYRRGGTDHITNMLIHETWASSIEALMRK
NKIIVDDAEEADTEPVSGGSPSQAEKCANRLAASRMCSGPTLLVQESLDCPRKDSVTECK
QPPVSSLSKTASLTNHSPLDSKKETSSCQDPVPINHKRRSLCSREVPLIQIETDQREACA
GEPEPFLSKSSLLEEAEGHSNDKNIPDVVRGGDTAVSACQIHSDSLDTRDVPEAEASTEA
RAPDEAPNPPSSSEESTGSWTQLANEEDNPDDTSSFLQLSERSMSNGNSSATSSLGIMDL
DIYQESMPSSPMINELVEEKKILKGQSESTEAPASGPPTGTASPQRSLLVINFDLEPECP
DAELRATLQWIAASELGIPTIYFKKSQENRIEKFLDVVQLVHRKSWKVGDIFHAVVQYCK
MHEEQKDGRLSLFDWLLELG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2M3C7	1.000	1.000	0.000	1700	1.000	1.000	Q2M3C7.pdb.gz	SPKAP_HUMAN A-kinase anchor protein SPHKAP OS=Homo sapiens OX=9606 GN=SPHKAP PE=1 SV=1
2	AFDB:Q6NSW3	0.344	0.346	0.000	1687	0.718	0.724	Q6NSW3.pdb.gz	SPKAP_MOUSE A-kinase anchor protein SPHKAP OS=Mus musculus OX=10090 GN=Sphkap PE=1 SV=2
3	AFDB:Q5A650	0.048	0.054	1.162E-3	1408	0.108	0.131	Q5A650.pdb.gz	Q5A650_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAK1 PE=4 SV=1
4	AFDB:Q6P1D7	0.037	0.039	1.900E-3	1565	0.112	0.122	Q6P1D7.pdb.gz	SLX4_MOUSE Structure-specific endonuclease subunit SLX4 OS=Mus musculus OX=10090 GN=Slx4 PE=1 SV=1
5	AFDB:Q0KHR2	0.039	0.037	2.007E-3	1918	0.125	0.111	Q0KHR2.pdb.gz	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
6	AFDB:Q6EMB2	0.049	0.057	4.311E-3	1281	0.076	0.101	Q6EMB2.pdb.gz	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
7	AFDB:E9PV87	0.041	0.044	8.769E-3	1520	0.123	0.138	E9PV87.pdb.gz	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1
8	AFDB:Q6P5H2	0.037	0.035	9.262E-3	1864	0.123	0.112	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
9	AFDB:A0A0R4INF0	0.039	0.039	1.152E-2	1570	0.122	0.132	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
10	AFDB:Q9UL36	0.056	0.052	1.152E-2	1845	0.104	0.096	Q9UL36.pdb.gz	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
11	PDB:6t9iE	0.030	0.083	1.931	433	0.019	0.074	6t9iE.pdb.gz
12	PDB:7o4i1	0.027	0.071	2.402	522	0.018	0.057	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:1tr2B	0.043	0.055	3.521	1029	0.019	0.031	1tr2B.pdb.gz
14	PDB:7mjpA	0.024	0.086	3.521	366	0.009	0.041	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
15	PDB:5n9jE	0.029	0.174	3.719	201	0.015	0.124	5n9jE.pdb.gz
16	PDB:6zqeUH	0.029	0.072	3.719	479	0.011	0.040	6zqeUH.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
17	PDB:1w0bA	0.032	0.339	3.928	102	0.011	0.176	1w0bA.pdb.gz
18	PDB:5oqj1	0.027	0.074	4.148	491	0.013	0.045	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
19	PDB:7jvrR	0.035	0.137	4.381	269	0.008	0.052	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:4h63H	0.024	0.139	4.627	174	0.012	0.121	4h63H.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2M3C7	0.0	3498	1700	1.000	1.000	SPKAP_HUMAN A-kinase anchor protein SPHKAP OS=Homo sapiens OX=9606 GN=SPHKAP PE=1 SV=1
2	Q6NSW3	0.0	2378	1687	0.723	0.729	SPKAP_MOUSE A-kinase anchor protein SPHKAP OS=Mus musculus OX=10090 GN=Sphkap PE=1 SV=2
3	Q9UKA4	2.16e-22	108	1901	0.114	0.102	AKA11_HUMAN A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1
4	Q8BSJ2	2.47e-18	92.8	521	0.058	0.190	Q8BSJ2_MOUSE A-kinase anchor 110kDa C-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Akap11 PE=2 SV=1
5	O77797	2.12e-10	68.2	858	0.023	0.045	AKAP3_BOVIN A-kinase anchor protein 3 OS=Bos taurus OX=9913 GN=AKAP3 PE=2 SV=2
6	Q62924	4.87e-10	67.4	1129	0.085	0.128	AKA11_RAT A-kinase anchor protein 11 OS=Rattus norvegicus OX=10116 GN=Akap11 PE=1 SV=1
7	O88987	5.66e-10	67.0	864	0.023	0.045	AKAP3_MOUSE A-kinase anchor protein 3 OS=Mus musculus OX=10090 GN=Akap3 PE=1 SV=2
8	O75969	2.87e-09	64.7	853	0.022	0.043	AKAP3_HUMAN A-kinase anchor protein 3 OS=Homo sapiens OX=9606 GN=AKAP3 PE=1 SV=2
9	Q60662	2.73e-08	61.2	849	0.018	0.035	AKAP4_MOUSE A-kinase anchor protein 4 OS=Mus musculus OX=10090 GN=Akap4 PE=1 SV=1
10	Q5JQC9	2.38e-07	58.2	854	0.018	0.035	AKAP4_HUMAN A-kinase anchor protein 4 OS=Homo sapiens OX=9606 GN=AKAP4 PE=1 SV=1
11	E9Q777	6.37e-04	47.4	1894	0.032	0.029	E9Q777_MOUSE A kinase (PRKA) anchor protein 11 OS=Mus musculus OX=10090 GN=Akap11 PE=1 SV=2
12	Q9SKB3	0.003	45.1	548	0.014	0.042	PARG1_ARATH Poly(ADP-ribose) glycohydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=PARG1 PE=1 SV=2
13	Q6ZQ80	0.022	42.0	1023	0.011	0.019	Q6ZQ80_MOUSE MKIAA0629 protein (Fragment) OS=Mus musculus OX=10090 GN=Akap11 PE=2 SV=1
14	Q8VYA1	0.056	40.4	522	0.012	0.040	PARG2_ARATH Probable poly(ADP-ribose) glycohydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=PARG2 PE=2 SV=1
15	O14529	0.65	37.4	1486	0.015	0.017	CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens OX=9606 GN=CUX2 PE=1 SV=4
16	A0A3G6VF52	3.3	34.7	588	0.024	0.068	A0A3G6VF52_HUMAN DAB1 OS=Homo sapiens OX=9606 GN=DAB1 PE=2 SV=1
17	O75553	3.3	34.7	588	0.024	0.068	DAB1_HUMAN Disabled homolog 1 OS=Homo sapiens OX=9606 GN=DAB1 PE=1 SV=3
18	Q66YX3	3.5	34.3	288	0.014	0.083	Q66YX3_BORBG Uncharacterized protein (Fragment) OS=Borreliella burgdorferi OX=139 GN=BBI38 PE=4 SV=1
19	A0A1D8PND0	3.7	34.7	827	0.022	0.046	A0A1D8PND0_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIX7 PE=4 SV=1
20	D4A3K7	7.0	33.9	1777	0.014	0.013	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05716 AKAP_110	8.4e-07	39.3	A-kinase anchor protein 110 kDa (AKAP 110)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313681	0.975	Sphingosine kinase 1
2	9606.ENSP00000342075	0.746	SUMO-interacting motif-containing protein 1
3	9606.ENSP00000356143	0.729	Leucine rich repeat neuronal 2
4	9606.ENSP00000280772	0.718	Ankyrin-3
5	9606.ENSP00000378306	0.715	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
6	9606.ENSP00000383105	0.676	GATOR complex protein DEPDC5
7	9606.ENSP00000451300	0.661	Protein numb homolog
8	9606.ENSP00000359216	0.656	Polypyrimidine tract-binding protein 2
9	9606.ENSP00000262570	0.620	MICOS complex subunit MIC19
10	9606.ENSP00000360069	0.598	Zinc finger protein 831
11	9606.ENSP00000334910	0.577	cGMP-dependent 3',5'-cyclic phosphodiesterase
12	9606.ENSP00000334319	0.567	Protein piccolo
13	9606.ENSP00000309117	0.562	RNA binding protein fox-1 homolog 1
14	9606.ENSP00000332565	0.550	Sulfotransferase 4A1
15	9606.ENSP00000324856	0.549	Serine/threonine-protein kinase STK11
16	9606.ENSP00000357067	0.532	G protein-activated inward rectifier potassium channel 3
17	9606.ENSP00000374135	0.532	Low-density lipoprotein receptor-related protein 1B
18	9606.ENSP00000405388	0.530	Carbonic anhydrase-related protein 10
19	9606.ENSP00000287907	0.524	5-hydroxytryptamine receptor 5A
20	9606.ENSP00000303252	0.521	Zinc finger protein 804A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0032501	0.873	multicellular organismal process
GO:0051179	0.857	localization
GO:0051716	0.687	cellular response to stimulus
GO:0033036	0.642	macromolecule localization
GO:0023052	0.558	signaling
GO:0007154	0.546	cell communication
GO:0007165	0.332	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0099080	0.998	supramolecular complex
GO:0005739	0.993	mitochondrion
GO:0030016	0.986	myofibril
GO:0030018	0.980	Z disc
GO:0016020	0.930	membrane
GO:0005886	0.904	plasma membrane
GO:0005829	0.530	cytosol
GO:0005634	0.501	nucleus
GO:0032991	0.479	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]