StarFunc result for job id Q2M3G0

User Input

>input (1257 residues)
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGA
CLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIF
GYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGD
KIALLFQNMSTFSIGLAVGLVKGWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYS
KAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIF
QVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISN
NIKYGRDDVTDEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALV
RNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFID
KAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLNGTVHPVFSIIFAKIITMF
GNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQD
IAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTA
IAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREV
SFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVD
AKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEG
LPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4m1mA	0.895	0.945	0.000	1188	0.535	0.566	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
2	PDB:6qexA	0.859	0.910	0.000	1182	0.543	0.577	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
3	PDB:7niwA	0.805	0.882	0.000	1140	0.524	0.578	7niwA.pdb.gz	Structures of ABCB4 provide insight into phosphatidylcholine translocation.
4	AFDB:A0A2R8QDG3	0.929	0.867	0.000	1350	0.503	0.468	A0A2R8QDG3.pdb.gz
5	AFDB:A4D1D2	0.930	0.914	0.000	1280	0.553	0.543	A4D1D2.pdb.gz	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	AFDB:B5X0E4	0.959	0.961	0.000	1255	0.780	0.781	B5X0E4.pdb.gz	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	AFDB:B8K1W2	0.903	0.858	0.000	1325	0.448	0.425	B8K1W2.pdb.gz	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	AFDB:E7EZD3	0.894	0.860	0.000	1308	0.460	0.442	E7EZD3.pdb.gz
9	AFDB:E7F1E3	0.928	0.915	0.000	1275	0.541	0.533	E7F1E3.pdb.gz	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
10	AFDB:G5EDF9	0.906	0.895	0.000	1272	0.407	0.402	G5EDF9.pdb.gz	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
11	AFDB:O70127	0.919	0.875	0.000	1321	0.459	0.437	O70127.pdb.gz	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
12	AFDB:O80725	0.930	0.909	0.000	1286	0.400	0.391	O80725.pdb.gz	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
13	AFDB:O95342	0.912	0.870	0.000	1321	0.459	0.437	O95342.pdb.gz	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
14	PDB:4f4cA	0.745	0.748	1.407E-94	1250	0.388	0.390	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
15	PDB:6lr0U	0.832	0.849	3.559E-91	1230	0.461	0.471	6lr0U.pdb.gz
16	PDB:7dv5U	0.878	0.927	2.497E-90	1189	0.454	0.480	7dv5U.pdb.gz	Structures of human bile acid exporter ABCB11 reveal a transport mechanism facilitated by two tandem substrate-binding pockets.
17	PDB:7vluA	0.570	0.607	3.814E-49	1159	0.171	0.186	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
18	PDB:6jb1B	0.656	0.610	5.430E-47	1366	0.169	0.156	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
19	PDB:7mpeA	0.658	0.592	1.205E-46	1428	0.177	0.155	7mpeA.pdb.gz
20	PDB:7s5xE	0.600	0.546	2.446E-46	1412	0.173	0.154	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6F1	755	721	0.293	0.510	A0A8I5Y6F1_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
2	A0A8I5ZY39	1418	1248	0.547	0.550	A0A8I5ZY39_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
3	A0A8I6GMN6	1422	1243	0.549	0.555	A0A8I6GMN6_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
4	A0MH69	1102	1336	0.476	0.448	A0MH69_ONCMY Bile salt export pump OS=Oncorhynchus mykiss OX=8022 GN=Abcb11 PE=2 SV=2
5	A4D1D2	1457	1280	0.551	0.541	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	B5X0E4	2058	1255	0.780	0.782	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	B8K1W2	1128	1325	0.461	0.438	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	E7F1E3	1438	1275	0.541	0.533	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
9	F1R7A8	1311	1338	0.507	0.476	F1R7A8_DANRE ABC transporter B family member 5 (Fragment) OS=Danio rerio OX=7955 GN=abcb5 PE=1 SV=1
10	F7FKA8	1436	1286	0.550	0.537	F7FKA8_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
11	G5EDF9	988	1272	0.417	0.412	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
12	G5EG61	780	1327	0.375	0.356	G5EG61_CAEEL p-GlycoProtein related OS=Caenorhabditis elegans OX=6239 GN=pgp-14 PE=1 SV=1
13	M9PEB5	825	1206	0.362	0.377	M9PEB5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=AMT PE=4 SV=1
14	O70127	1133	1321	0.469	0.447	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
15	O80725	921	1286	0.399	0.390	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
16	O93437	1409	1288	0.543	0.530	O93437_CHICK ABC transporter protein (P-glycoprotein) OS=Gallus gallus OX=9031 GN=cmdr1 PE=2 SV=2
17	O95342	1151	1321	0.477	0.453	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
18	P06795	1449	1276	0.551	0.542	MDR1B_MOUSE ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1b PE=1 SV=1
19	P08183	1457	1280	0.551	0.541	MDR1_HUMAN ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3
20	P21439	1408	1286	0.543	0.531	MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens OX=9606 GN=ABCB4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	0.045	25.2	AAA domain
2	PF13175 AAA_15	0.077	24.1	AAA ATPase domain
3	PF13191 AAA_16	6.2e-06	38.2	AAA ATPase domain
4	PF13238 AAA_18	1.8	20.5	AAA domain
5	PF13304 AAA_21	0.17	23.3	AAA domain, putative AbiEii toxin, Type IV TA system
6	PF13401 AAA_22	0.0026	29.5	AAA domain
7	PF13476 AAA_23	5.7e+02	12.4	AAA domain
8	PF13481 AAA_25	5.7	18.0	AAA domain
9	PF13521 AAA_28	10	17.8	AAA domain
10	PF13555 AAA_29	0.011	26.7	P-loop containing region of AAA domain
11	PF13604 AAA_30	0.092	24.0	AAA domain
12	PF13671 AAA_33	0.45	22.1	AAA domain
13	PF07728 AAA_5	0.12	23.8	AAA domain (dynein-related subfamily)
14	PF12775 AAA_7	1.6	19.8	P-loop containing dynein motor region
15	PF09818 ABC_ATPase	2e-05	35.4	ATPase of the ABC class
16	PF00664 ABC_membrane	7.9e-132	450.6	ABC transporter transmembrane region
17	PF00005 ABC_tran	3.4e-70	246.3	ABC transporter
18	PF01583 APS_kinase	47	15.3	Adenylylsulphate kinase
19	PF00006 ATP-synt_ab	3.6e+02	12.2	ATP synthase alpha/beta family, nucleotide-binding domain
20	PF09972 DUF2207	44	14.3	Predicted membrane protein (DUF2207)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384881

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345708	0.775	ATP-sensitive inward rectifier potassium channel 11
2	9606.ENSP00000296577	0.677	ATP-binding cassette sub-family E member 1
3	9606.ENSP00000426809	0.677	Prominin-1
4	9606.ENSP00000236850	0.662	Apolipoprotein A-I
5	9606.ENSP00000273173	0.661	Solute carrier family 22 member 14
6	9606.ENSP00000421339	0.652	Solute carrier organic anion transporter family member 6A1
7	9606.ENSP00000353791	0.633	Sodium- and chloride-dependent glycine transporter 1
8	9606.ENSP00000172229	0.619	Tumor necrosis factor receptor superfamily member 16
9	9606.ENSP00000356234	0.595	Lysine-specific demethylase 5B
10	9606.ENSP00000260126	0.587	Solute carrier organic anion transporter family member 5A1
11	9606.ENSP00000398632	0.569	CD44 antigen
12	9606.ENSP00000316909	0.561	Vesicular glutamate transporter 3
13	9606.ENSP00000253727	0.519	Oxysterols receptor LXR-beta
14	9606.ENSP00000356959	0.517	Nuclear receptor subfamily 1 group I member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042626	0.997	ATPase-coupled transmembrane transporter activity
GO:0005488	0.995	binding
GO:0005515	0.993	protein binding
GO:0015562	0.990	efflux transmembrane transporter activity
GO:0005319	0.879	lipid transporter activity
GO:0140359	0.530	ABC-type transporter activity
GO:0042910	0.440	xenobiotic transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.952	cellular process
GO:0051179	0.912	localization
GO:0065007	0.908	biological regulation
GO:0006810	0.898	transport
GO:0050896	0.780	response to stimulus
GO:0050789	0.722	regulation of biological process
GO:0050794	0.654	regulation of cellular process
GO:0032501	0.527	multicellular organismal process
GO:0051716	0.405	cellular response to stimulus
GO:0008152	0.361	metabolic process
GO:0048518	0.358	positive regulation of biological process
GO:0042221	0.342	response to chemical
GO:0048856	0.326	anatomical structure development
GO:0071704	0.301	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.789	intracellular anatomical structure
GO:0005737	0.680	cytoplasm
GO:0043227	0.656	membrane-bounded organelle
GO:0043231	0.427	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.998	Translocases.

[back to server]