StarFunc result for job id Q2MJR0

User Input

>input (410 residues)
MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKT
TLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTP
SSSSSSSSPSQDTAETPCPLTSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTP
PQRRRSSAQSYPPLLPFTGIPEPSEPLAGAGGLGWGGRGYEDYRRSGPPAPLALSTCVVR
FAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGPSSAPAKASPEAEEAARCVHC
RALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSDPCACEPGH
PRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P6N5	0.585	0.588	2.392E-63	408	0.944	0.949	Q6P6N5.pdb.gz	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
2	AFDB:Q7Z698	0.458	0.451	1.257E-32	418	0.371	0.364	Q7Z698.pdb.gz	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
3	AFDB:F0JAK5	0.483	0.490	1.943E-26	404	0.317	0.322	F0JAK5.pdb.gz	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
4	AFDB:Q7K0G4	0.382	0.370	5.181E-26	426	0.307	0.296	Q7K0G4.pdb.gz	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
5	AFDB:G5EG53	0.253	0.222	1.069E-8	468	0.176	0.154	G5EG53.pdb.gz	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
6	PDB:3m1iB	0.222	0.641	5.004E-5	131	0.049	0.153	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
7	AFDB:Q9SJF3	0.229	0.254	1.031E-4	367	0.127	0.142	Q9SJF3.pdb.gz	DCP1_ARATH mRNA-decapping enzyme-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g08370 PE=1 SV=2
8	AFDB:Q9WTP2	0.185	0.246	3.463E-4	300	0.171	0.233	Q9WTP2.pdb.gz	SPY4_MOUSE Protein sprouty homolog 4 OS=Mus musculus OX=10090 GN=Spry4 PE=1 SV=1
9	PDB:1k5dB	0.222	0.575	1.342E-3	146	0.037	0.103	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
10	AFDB:B5DFH3	0.183	0.231	2.764E-3	313	0.141	0.185	B5DFH3.pdb.gz	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
11	AFDB:F6NGQ6	0.154	0.111	6.200E-3	589	0.127	0.088	F6NGQ6.pdb.gz	F6NGQ6_DANRE DAB adaptor protein 2 OS=Danio rerio OX=7955 GN=sb:cb778 PE=1 SV=1
12	PDB:2qkmG	0.183	0.499	9.005E-3	127	0.034	0.110	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
13	PDB:1q67B	0.223	0.514	1.134E-2	161	0.029	0.075	1q67B.pdb.gz
14	PDB:7ploO	0.196	0.209	1.514E-2	382	0.037	0.039	7ploO.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:6oxlN	0.192	0.540	1.699E-2	124	0.037	0.121	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
16	AFDB:O44783	0.184	0.135	2.206E-2	589	0.202	0.141	O44783.pdb.gz	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
17	PDB:6am0F	0.196	0.415	2.401E-2	178	0.037	0.084	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
18	PDB:2kr0A	0.190	0.191	3.810E-2	407	0.044	0.044	2kr0A.pdb.gz
19	PDB:5n47A	0.106	0.197	6.784E-2	180	0.054	0.122	5n47A.pdb.gz
20	PDB:7pgrN	0.156	0.032	6.784E-2	2423	0.027	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P6N5	0.0	561	408	0.944	0.949	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
2	Q924S7	1.67e-90	281	410	0.405	0.405	SPRE2_MOUSE Sprouty-related, EVH1 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Spred2 PE=1 SV=1
3	Q7Z698	1.39e-89	279	418	0.405	0.397	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
4	Q6NV01	1.18e-76	244	391	0.390	0.409	Q6NV01_DANRE Sprouty-related, EVH1 domain containing 1 OS=Danio rerio OX=7955 GN=zgc:85707 PE=2 SV=1
5	Q7Z699	1.03e-75	244	444	0.373	0.345	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
6	Q924S8	1.76e-71	233	444	0.363	0.336	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1
7	Q7K0G4	1.06e-45	164	426	0.324	0.312	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
8	H0YMN8	6.27e-32	119	131	0.161	0.504	H0YMN8_HUMAN Sprouty related EVH1 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=1
9	A0A0B4KG11	4.67e-23	103	519	0.134	0.106	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
10	F0JAK5	2.02e-19	91.7	404	0.124	0.126	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
11	Q9UI08	3.60e-13	72.8	416	0.090	0.089	EVL_HUMAN Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2
12	O08719	8.70e-13	71.6	420	0.083	0.081	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
13	P70429	1.17e-12	71.2	414	0.083	0.082	EVL_MOUSE Ena/VASP-like protein OS=Mus musculus OX=10090 GN=Evl PE=1 SV=2
14	Q8T4F7	2.06e-12	71.2	980	0.088	0.037	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
15	Q03173	2.10e-12	71.2	802	0.090	0.046	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
16	A0A8I6GMP8	2.14e-12	71.2	788	0.080	0.042	A0A8I6GMP8_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
17	A0A8I5ZT50	2.18e-12	71.2	803	0.090	0.046	A0A8I5ZT50_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
18	A0A8I6G5W6	2.36e-12	71.2	788	0.080	0.042	A0A8I6G5W6_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
19	A0A8I5Y4S4	2.47e-12	71.2	805	0.080	0.041	A0A8I5Y4S4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
20	A0A0U1RRM6	3.91e-12	70.5	802	0.080	0.041	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05210 Sprouty	8.7e-26	102.0	Sprouty protein (Spry)
2	PF00568 WH1	3.4e-07	41.6	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270586	0.903	Proteasome subunit beta type-6
2	9606.ENSP00000363993	0.903	Proteasome subunit beta type-9
3	9606.ENSP00000216455	0.902	Proteasome subunit alpha type-3
4	9606.ENSP00000271308	0.902	Proteasome subunit alpha type-5
5	9606.ENSP00000309474	0.902	26S proteasome non-ATPase regulatory subunit 1
6	9606.ENSP00000272317	0.901	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000044462	0.900	Proteasome subunit alpha type-4
8	9606.ENSP00000157812	0.900	26S proteasome regulatory subunit 6B
9	9606.ENSP00000210313	0.900	26S proteasome non-ATPase regulatory subunit 5
10	9606.ENSP00000215071	0.900	26S proteasome non-ATPase regulatory subunit 8
11	9606.ENSP00000216225	0.900	E3 ubiquitin-protein ligase RBX1
12	9606.ENSP00000216802	0.900	Proteasome activator complex subunit 2
13	9606.ENSP00000217958	0.900	26S proteasome non-ATPase regulatory subunit 10
14	9606.ENSP00000219313	0.900	26S proteasome non-ATPase regulatory subunit 7
15	9606.ENSP00000223321	0.900	Proteasome subunit alpha type-2
16	9606.ENSP00000259457	0.900	Proteasome subunit beta type-7
17	9606.ENSP00000261303	0.900	26S proteasome regulatory subunit 4
18	9606.ENSP00000261479	0.900	Proteasome subunit alpha type-6
19	9606.ENSP00000261712	0.900	26S proteasome non-ATPase regulatory subunit 11
20	9606.ENSP00000262193	0.900	Proteasome subunit beta type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.988	enzyme binding
GO:0019901	0.977	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0048523	0.976	negative regulation of cellular process
GO:1902531	0.926	regulation of intracellular signal transduction
GO:0009968	0.926	negative regulation of signal transduction
GO:0090287	0.810	regulation of cellular response to growth factor stimulus
GO:0043409	0.802	negative regulation of MAPK cascade
GO:0070372	0.767	regulation of ERK1 and ERK2 cascade
GO:0010717	0.714	regulation of epithelial to mesenchymal transition
GO:0090092	0.705	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051093	0.697	negative regulation of developmental process
GO:0051241	0.666	negative regulation of multicellular organismal process
GO:0017015	0.644	regulation of transforming growth factor beta receptor signaling pathway
GO:0030856	0.640	regulation of epithelial cell differentiation
GO:0070373	0.627	negative regulation of ERK1 and ERK2 cascade
GO:0030857	0.610	negative regulation of epithelial cell differentiation
GO:0090101	0.565	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030512	0.562	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0009987	0.550	cellular process
GO:0019222	0.360	regulation of metabolic process
GO:0080090	0.311	regulation of primary metabolic process
GO:0060255	0.311	regulation of macromolecule metabolic process
GO:0051171	0.311	regulation of nitrogen compound metabolic process
GO:0051246	0.304	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.996	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005622	0.955	intracellular anatomical structure
GO:0005737	0.950	cytoplasm
GO:0005829	0.927	cytosol
GO:0032991	0.510	protein-containing complex
GO:0031981	0.406	nuclear lumen
GO:0005654	0.384	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]