StarFunc result for job id Q2MKA7

User Input

>input (263 residues)
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2MKA7	1.000	1.000	2.048E-47	263	1.000	1.000	Q2MKA7.pdb.gz	RSPO1_HUMAN R-spondin-1 OS=Homo sapiens OX=9606 GN=RSPO1 PE=1 SV=1
2	AFDB:Q9Z132	0.605	0.601	1.644E-40	265	0.882	0.875	Q9Z132.pdb.gz	RSPO1_MOUSE R-spondin-1 OS=Mus musculus OX=10090 GN=Rspo1 PE=1 SV=1
3	AFDB:Q6DHR0	0.466	0.468	1.406E-26	261	0.506	0.510	Q6DHR0.pdb.gz	RSPO1_DANRE R-spondin-1 OS=Danio rerio OX=7955 GN=rspo1 PE=2 SV=1
4	AFDB:Q2TJ95	0.384	0.366	3.496E-25	277	0.422	0.401	Q2TJ95.pdb.gz	RSPO3_MOUSE R-spondin-3 OS=Mus musculus OX=10090 GN=Rspo3 PE=1 SV=2
5	AFDB:F1Q5C9	0.427	0.449	1.353E-24	248	0.338	0.359	F1Q5C9.pdb.gz	F1Q5C9_DANRE R-spondin 2 OS=Danio rerio OX=7955 GN=si:ch211-149p10.1 PE=2 SV=1
6	AFDB:Q9BXY4	0.381	0.369	3.151E-24	272	0.418	0.404	Q9BXY4.pdb.gz	RSPO3_HUMAN R-spondin-3 OS=Homo sapiens OX=9606 GN=RSPO3 PE=1 SV=1
7	AFDB:Q6UXX9	0.400	0.431	8.216E-24	243	0.361	0.391	Q6UXX9.pdb.gz	RSPO2_HUMAN R-spondin-2 OS=Homo sapiens OX=9606 GN=RSPO2 PE=1 SV=2
8	AFDB:Q5R328	0.356	0.298	7.835E-23	317	0.399	0.331	Q5R328.pdb.gz	RSPO3_DANRE R-spondin-3 OS=Danio rerio OX=7955 GN=rspo3 PE=2 SV=2
9	AFDB:Q2I0M5	0.398	0.443	5.173E-19	234	0.335	0.376	Q2I0M5.pdb.gz	RSPO4_HUMAN R-spondin-4 OS=Homo sapiens OX=9606 GN=RSPO4 PE=1 SV=2
10	AFDB:Q9UPZ6	0.205	0.036	1.163E-3	1657	0.084	0.013	Q9UPZ6.pdb.gz	THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A OS=Homo sapiens OX=9606 GN=THSD7A PE=1 SV=4
11	PDB:1w0rA	0.183	0.116	1.254E-2	442	0.129	0.077	1w0rA.pdb.gz
12	PDB:7bwaA	0.144	0.067	5.748E-2	674	0.103	0.040	7bwaA.pdb.gz
13	PDB:7nydE	0.189	0.109	9.024E-2	484	0.065	0.035	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:6pxvA	0.141	0.063	1.196E-1	823	0.091	0.029	6pxvA.pdb.gz
15	PDB:2luuA	0.128	0.217	1.266E-1	127	0.118	0.244	2luuA.pdb.gz
16	PDB:3ojyB	0.153	0.084	1.499E-1	504	0.061	0.032	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
17	PDB:3t5oA	0.160	0.054	1.499E-1	871	0.042	0.013	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
18	PDB:2lutA	0.128	0.215	1.878E-1	125	0.122	0.256	2lutA.pdb.gz
19	PDB:4e0sB	0.180	0.063	2.102E-1	898	0.080	0.023	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:7nydG	0.172	0.114	2.102E-1	413	0.057	0.036	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2MKA7	0.0	534	263	1.000	1.000	RSPO1_HUMAN R-spondin-1 OS=Homo sapiens OX=9606 GN=RSPO1 PE=1 SV=1
2	Q9Z132	3.60e-171	474	265	0.882	0.875	RSPO1_MOUSE R-spondin-1 OS=Mus musculus OX=10090 GN=Rspo1 PE=1 SV=1
3	Q6DHR0	3.06e-82	249	261	0.525	0.529	RSPO1_DANRE R-spondin-1 OS=Danio rerio OX=7955 GN=rspo1 PE=2 SV=1
4	Q2TJ95	3.18e-71	221	277	0.399	0.379	RSPO3_MOUSE R-spondin-3 OS=Mus musculus OX=10090 GN=Rspo3 PE=1 SV=2
5	Q9BXY4	1.83e-70	219	272	0.430	0.415	RSPO3_HUMAN R-spondin-3 OS=Homo sapiens OX=9606 GN=RSPO3 PE=1 SV=1
6	Q8BFU0	2.15e-57	185	243	0.354	0.383	RSPO2_MOUSE R-spondin-2 OS=Mus musculus OX=10090 GN=Rspo2 PE=1 SV=1
7	Q6UXX9	2.70e-57	185	243	0.354	0.383	RSPO2_HUMAN R-spondin-2 OS=Homo sapiens OX=9606 GN=RSPO2 PE=1 SV=2
8	F1Q5C9	2.09e-56	182	248	0.373	0.395	F1Q5C9_DANRE R-spondin 2 OS=Danio rerio OX=7955 GN=si:ch211-149p10.1 PE=2 SV=1
9	Q5R328	6.84e-54	178	317	0.380	0.315	RSPO3_DANRE R-spondin-3 OS=Danio rerio OX=7955 GN=rspo3 PE=2 SV=2
10	Q2I0M5	2.41e-43	149	234	0.312	0.350	RSPO4_HUMAN R-spondin-4 OS=Homo sapiens OX=9606 GN=RSPO4 PE=1 SV=2
11	P30432	9.19e-08	55.1	1679	0.122	0.019	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
12	Q04592	5.00e-07	52.8	1877	0.160	0.022	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
13	P41413	6.67e-07	52.4	1809	0.160	0.023	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
14	A0A669KA35	1.49e-05	48.5	1887	0.148	0.021	A0A669KA35_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
15	Q92824	1.91e-05	48.1	1860	0.148	0.021	PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=4
16	Q5JSG7	2.67e-05	47.8	1560	0.160	0.027	Q5JSG7_HUMAN Proprotein convertase subtilisin/kexin type 5 (Fragment) OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
17	P29122	1.40e-04	45.4	969	0.129	0.035	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
18	A7MBS7	1.44e-04	45.4	1686	0.091	0.014	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
19	A0A0R4IQJ3	1.91e-04	45.1	4003	0.087	0.006	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
20	F1Q633	2.05e-04	45.1	3970	0.087	0.006	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15913 Furin-like_2	8.5e-42	152.9	Furin-like repeat, cysteine-rich
2	PF19028 TSP1_spondin	1.8e-05	36.3	Spondin-like TSP1 domain
3	PF00090 TSP_1	0.53	21.8	Thrombospondin type 1 domain
4	PF03302 VSP	4e+02	11.2	Giardia variant-specific surface protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266674	0.999	Leucine-rich repeat-containing G-protein coupled receptor 5
2	9606.ENSP00000368516	0.999	Leucine-rich repeat-containing G-protein coupled receptor 4
3	9606.ENSP00000443824	0.999	E3 ubiquitin-protein ligase ZNRF3
4	9606.ENSP00000463069	0.999	E3 ubiquitin-protein ligase RNF43
5	9606.ENSP00000261349	0.996	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000356247	0.986	Leucine-rich repeat-containing G-protein coupled receptor 6
7	9606.ENSP00000363081	0.963	Dickkopf-related protein 1
8	9606.ENSP00000290167	0.943	Protein Wnt-4
9	9606.ENSP00000284523	0.939	Protein Wnt-3a
10	9606.ENSP00000217260	0.910	R-spondin-4
11	9606.ENSP00000276659	0.910	R-spondin-2
12	9606.ENSP00000349131	0.908	R-spondin-3
13	9606.ENSP00000294304	0.907	Low-density lipoprotein receptor-related protein 5
14	9606.ENSP00000304697	0.904	Polyubiquitin-B
15	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
16	9606.ENSP00000441543	0.903	Polyubiquitin-C
17	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
18	9606.ENSP00000333188	0.878	Forkhead box protein L2
19	9606.ENSP00000328181	0.872	Noggin
20	9606.ENSP00000344456	0.820	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0001664	0.987	G protein-coupled receptor binding
GO:0097367	0.528	carbohydrate derivative binding
GO:0008201	0.497	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.978	positive regulation of cellular process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0009966	0.948	regulation of signal transduction
GO:0060828	0.932	regulation of canonical Wnt signaling pathway
GO:0030177	0.910	positive regulation of Wnt signaling pathway
GO:0032501	0.793	multicellular organismal process
GO:0009987	0.745	cellular process
GO:0080090	0.739	regulation of primary metabolic process
GO:0051171	0.738	regulation of nitrogen compound metabolic process
GO:0031323	0.696	regulation of cellular metabolic process
GO:0010604	0.677	positive regulation of macromolecule metabolic process
GO:0032502	0.641	developmental process
GO:0048856	0.632	anatomical structure development
GO:0007275	0.548	multicellular organism development
GO:0051173	0.482	positive regulation of nitrogen compound metabolic process
GO:0031325	0.474	positive regulation of cellular metabolic process
GO:0050896	0.443	response to stimulus
GO:0051246	0.384	regulation of protein metabolic process
GO:0090263	0.358	positive regulation of canonical Wnt signaling pathway
GO:0010468	0.351	regulation of gene expression
GO:0051716	0.329	cellular response to stimulus
GO:0051128	0.314	regulation of cellular component organization
GO:0051247	0.302	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.968	intracellular anatomical structure
GO:0043226	0.966	organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005615	0.505	extracellular space
GO:0071944	0.468	cell periphery
GO:0016020	0.408	membrane
GO:0005634	0.408	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]