StarFunc result for job id Q2NKJ3

User Input

>input (1217 residues)
MAAGRAQVPSSEQAWLEDAQVFIQKTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRNQGST
LPLSYSFVSVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAGPNGNPLPREQLLLLGTLTDL
SADLEQECRNGSLYVRDNTGVLSCELIDLDLSWLGHLFLFPRWSYLPPARWNSSGEGHLE
LWDAPVPVFPLTISPGPVTPIPVLYPESASCLLRLRNKLRGVQRNLAGSLVRLSALVKSK
QKAYFILSLGRSHPAVTHVSIIVQVPAQLVWHRALRPGTAYVLTELRVSKIRGQRQHVWM
TSQSSRLLLLKPECVQELELELEGPLLEADPKPLPMPSNSEDKKDPESLVRYSRLLSYSG
AVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPV
LAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACK
LCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKY
TRLQTPSSFPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSCQLNRRLAWSWLCLLPS
AFCPAQVLLGVLVASSHKGCLQLRDQSGSLPCLLLAKHSQPLSDPRLIGCLVRAERFQLI
VERDVRSSFPSWKELSMPGFIQKQQARVYVQFFLADALILPVPRPCLHSATPSTPQTDPT
GPEGPHLGQSRLFLLCHKEALMKRNFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTG
WGLPEPQGNDDNDQKVHLIFFGSSVRWFEFLHPGQVYRLIAPGPATPMLFEKDGSSCISR
RPLELAGCASCLTVQDNWTLELESSQDIQDVLDANKSLPESSLTDLLSDNFTDSLVSFSA
EILSRTLCEPLVASLWMKLGNTGAMRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLG
LLPGARVHFSQLEKRVSRSHNVYCCFRSSTYVQVLSFPPETTISIPLPHIYLAELLQGGQ
SPFQATASCHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPTQTAISQAIIRLLVEDG
TAEAVVTCRNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTM
FLWTLCTSPSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLS
IRESEYSSSLGILASSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6w6wA	0.712	0.949	0.000	905	0.734	0.987	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
2	PDB:7u5cE	0.901	0.954	0.000	1147	0.942	0.999	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
3	PDB:8d0bA	0.872	0.948	0.000	1116	0.914	0.996	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
4	AFDB:Q2NKJ3	1.000	1.000	0.000	1217	1.000	1.000	Q2NKJ3.pdb.gz	CTC1_HUMAN CST complex subunit CTC1 OS=Homo sapiens OX=9606 GN=CTC1 PE=1 SV=2
5	AFDB:Q5SUQ9	0.944	0.948	0.000	1212	0.687	0.690	Q5SUQ9.pdb.gz	CTC1_MOUSE CST complex subunit CTC1 OS=Mus musculus OX=10090 GN=Ctc1 PE=1 SV=2
6	AFDB:F4JKR3	0.461	0.445	3.959E-43	1274	0.165	0.158	F4JKR3.pdb.gz	F4JKR3_ARATH CST complex subunit CTC1 OS=Arabidopsis thaliana OX=3702 GN=CTC1 PE=1 SV=1
7	AFDB:Q9SD82	0.108	0.188	2.099E-17	604	0.058	0.116	Q9SD82.pdb.gz	RFA1B_ARATH Replication protein A 70 kDa DNA-binding subunit B OS=Arabidopsis thaliana OX=3702 GN=RPA1B PE=3 SV=1
8	AFDB:Q4Q884	0.120	0.238	6.164E-16	467	0.058	0.150	Q4Q884.pdb.gz	Q4Q884_LEIMA Replication protein A subunit OS=Leishmania major OX=5664 GN=RPA1 PE=3 SV=1
9	AFDB:Q10Q08	0.119	0.208	1.378E-15	630	0.055	0.106	Q10Q08.pdb.gz	RFA1B_ORYSJ Replication protein A 70 kDa DNA-binding subunit B OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1B PE=1 SV=1
10	AFDB:Q384B5	0.114	0.246	2.769E-15	463	0.058	0.153	Q384B5.pdb.gz	Q384B5_TRYB2 Replication protein A subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0870 PE=3 SV=1
11	AFDB:Q6NY74	0.119	0.215	3.821E-15	601	0.067	0.136	Q6NY74.pdb.gz	RFA1_DANRE Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio OX=7955 GN=rpa1 PE=1 SV=1
12	AFDB:Q5ZJJ2	0.134	0.233	5.869E-15	614	0.066	0.130	Q5ZJJ2.pdb.gz	RFA1_CHICK Replication protein A 70 kDa DNA-binding subunit OS=Gallus gallus OX=9031 GN=RPA1 PE=2 SV=1
13	AFDB:Q19537	0.149	0.234	6.893E-15	655	0.065	0.121	Q19537.pdb.gz	RFA1_CAEEL Probable replication factor A 73 kDa subunit OS=Caenorhabditis elegans OX=6239 GN=rpa-1 PE=1 SV=1
14	PDB:7uy5I	0.186	0.382	1.879E-12	528	0.046	0.106	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:7uy7A	0.185	0.360	1.696E-11	552	0.053	0.118	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
16	PDB:2i0qA	0.106	0.232	9.108E-7	461	0.047	0.124	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
17	PDB:7qxbP	0.116	0.465	6.661E-5	251	0.019	0.092	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
18	PDB:3k81D	0.065	0.566	3.725E-3	106	0.010	0.113	3k81D.pdb.gz
19	PDB:4owwB	0.063	0.562	4.147E-3	107	0.016	0.178	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
20	PDB:7lmaD	0.100	0.554	9.273E-3	187	0.018	0.118	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2NKJ3	0.0	2454	1217	1.000	1.000	CTC1_HUMAN CST complex subunit CTC1 OS=Homo sapiens OX=9606 GN=CTC1 PE=1 SV=2
2	Q5SUQ9	0.0	1613	1212	0.684	0.687	CTC1_MOUSE CST complex subunit CTC1 OS=Mus musculus OX=10090 GN=Ctc1 PE=1 SV=2
3	P21190	0.39	37.0	360	0.016	0.056	IME1_YEAST Meiosis-inducing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IME1 PE=1 SV=1
4	P41777	1.3	35.8	704	0.015	0.026	NOLC1_RAT Nucleolar and coiled-body phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Nolc1 PE=1 SV=2
5	Q76LC6	6.3	32.7	230	0.015	0.078	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
6	O60081	7.1	33.5	1502	0.021	0.017	THADA_SCHPO tRNA (32-2'-O)-methyltransferase regulator trm732 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm732 PE=3 SV=1
7	Q9U0J0	9.3	33.1	1145	0.009	0.010	Q9U0J0_PLAF7 Replication protein A1, large subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0409600 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15489 CTC1	0	2172.2	CST, telomere maintenance, complex subunit CTC1
2	PF15491 CTC1_2	4.6	18.2	CST, telomere maintenance, complex subunit CTC1
3	PF10497 zf-4CXXC_R1	2.5e+02	13.3	Zinc-finger domain of monoamine-oxidase A repressor R1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224950	0.999	CST complex subunit STN1
2	9606.ENSP00000380762	0.999	CST complex subunit TEN1
3	9606.ENSP00000267415	0.958	TERF1-interacting nuclear factor 2
4	9606.ENSP00000350249	0.943	Protection of telomeres protein 1
5	9606.ENSP00000254942	0.940	Telomeric repeat-binding factor 2
6	9606.ENSP00000276603	0.922	Telomeric repeat-binding factor 1
7	9606.ENSP00000274606	0.908	H/ACA ribonucleoprotein complex subunit 2
8	9606.ENSP00000332198	0.908	H/ACA ribonucleoprotein complex subunit 3
9	9606.ENSP00000353332	0.896	Regulator of telomere elongation helicase 1
10	9606.ENSP00000483117	0.891	Adrenocortical dysplasia protein homolog
11	9606.ENSP00000309572	0.876	Telomerase reverse transcriptase
12	9606.ENSP00000463762	0.831	Telomere repeats-binding bouquet formation protein 1
13	9606.ENSP00000300086	0.828	Telomeric repeat-binding factor 2-interacting protein 1
14	9606.ENSP00000299427	0.818	Tripeptidyl-peptidase 1
15	9606.ENSP00000352257	0.805	X-ray repair cross-complementing protein 6
16	9606.ENSP00000358563	0.789	H/ACA ribonucleoprotein complex subunit 4
17	9606.ENSP00000324203	0.775	Telomerase Cajal body protein 1
18	9606.ENSP00000375978	0.771	X-ray repair cross-complementing protein 5
19	9606.ENSP00000301896	0.764	Membrane-anchored junction protein
20	9606.ENSP00000262315	0.753	Chromosome transmission fidelity protein 18 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043047	1.000	single-stranded telomeric DNA binding
GO:0098505	0.988	G-rich strand telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0044238	0.992	primary metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0044260	0.984	cellular macromolecule metabolic process
GO:0090304	0.984	nucleic acid metabolic process
GO:0048523	0.981	negative regulation of cellular process
GO:0019222	0.980	regulation of metabolic process
GO:0033044	0.975	regulation of chromosome organization
GO:0006259	0.970	DNA metabolic process
GO:0071840	0.968	cellular component organization or biogenesis
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0016043	0.964	cellular component organization
GO:0080090	0.964	regulation of primary metabolic process
GO:0031324	0.960	negative regulation of cellular metabolic process
GO:0019219	0.945	regulation of nucleobase-containing compound metabolic process
GO:2000278	0.936	regulation of DNA biosynthetic process
GO:0045934	0.936	negative regulation of nucleobase-containing compound metabolic process
GO:0006996	0.930	organelle organization
GO:0000723	0.922	telomere maintenance
GO:0051053	0.921	negative regulation of DNA metabolic process
GO:0032204	0.887	regulation of telomere maintenance
GO:0051129	0.787	negative regulation of cellular component organization
GO:0010558	0.714	negative regulation of macromolecule biosynthetic process
GO:0031327	0.713	negative regulation of cellular biosynthetic process
GO:1904356	0.709	regulation of telomere maintenance via telomere lengthening
GO:2001251	0.689	negative regulation of chromosome organization
GO:0032210	0.689	regulation of telomere maintenance via telomerase
GO:0048518	0.642	positive regulation of biological process
GO:0048522	0.572	positive regulation of cellular process
GO:0016233	0.480	telomere capping
GO:0051054	0.469	positive regulation of DNA metabolic process
GO:2000279	0.464	negative regulation of DNA biosynthetic process
GO:0050896	0.393	response to stimulus
GO:0032211	0.320	negative regulation of telomere maintenance via telomerase
GO:0051716	0.309	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000783	0.999	nuclear telomere cap complex
GO:0005829	0.997	cytosol
GO:1990879	0.761	CST complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]