StarFunc result for job id Q2NKX8

User Input

>input (1250 residues)
MEASRRFPEAEALSPEQAAHYLRYVKEAKEATKNGDLEEAFKLFNLAKDIFPNEKVLSRI
QKIQEALEELAEQGDDEFTDVCNSGLLLYRELHNQLFEHQKEGIAFLYSLYRDGRKGGIL
ADDMGLGKTVQIIAFLSGMFDASLVNHVLLIMPTNLINTWVKEFIKWTPGMRVKTFHGPS
KDERTRNLNRIQQRNGVIITTYQMLINNWQQLSSFRGQEFVWDYVILDEAHKIKTSSTKS
AICARAIPASNRLLLTGTPIQNNLQELWSLFDFACQGSLLGTLKTFKMEYENPITRAREK
DATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPS
LSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSAR
ACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTLMEESGKMIFLMDLLKRLRDEGHQTL
VFSQSRQILNIIERLLKNRHFKTLRIDGTVTHLLEREKRINLFQQNKDYSVFLLTTQVGG
VGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVF
KDSLIRQTTGEKKNPFRYFSKQELRELFTIEDLQNSVTQLQLQSLHAAQRKSDIKLDEHI
AYLQSLGIAGISDHDLMYTCDLSVKEELDVVEESHYIQQRVQKAQFLVEFESQNKEFLME
QQRTRNEGAWLREPVFPSSTKKKCPKLNKPQPQPSPLLSTHHTQEEDISSKMASVVIDDL
PKEGEKQDLSSIKVNVTTLQDGKGTGSADSIATLPKGFGSVEELCTNSSLGMEKSFATKN
EAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADIGPNLDQLKDDEILRHCNPWPIIS
ITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDS
ADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIR
SKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIP
SSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASK
YTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDY
ETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2NKX8	1.000	1.000	0.000	1250	1.000	1.000	Q2NKX8.pdb.gz	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
2	PDB:7oo3b	0.387	0.883	3.691E-42	534	0.162	0.380	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
3	PDB:6jylK	0.331	0.782	1.531E-30	504	0.138	0.341	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
4	PDB:5vvrM	0.333	0.778	8.150E-30	503	0.142	0.352	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
5	AFDB:Q9NEL2	0.357	0.191	1.079E-29	2395	0.211	0.110	Q9NEL2.pdb.gz	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
6	PDB:6tdaS	0.315	0.489	4.376E-28	783	0.136	0.217	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
7	AFDB:Q54UZ8	0.339	0.184	2.295E-27	2373	0.211	0.111	Q54UZ8.pdb.gz	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
8	PDB:7epuB	0.228	0.342	2.256E-25	748	0.134	0.225	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
9	AFDB:P46100	0.408	0.211	5.387E-25	2492	0.155	0.078	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
10	PDB:6uxwA	0.334	0.517	7.343E-25	778	0.138	0.221	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:6g0lM	0.306	0.441	1.143E-24	855	0.124	0.181	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6gejM	0.315	0.554	1.963E-24	688	0.126	0.228	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6g0lW	0.304	0.426	1.336E-23	878	0.132	0.188	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:6kw3Y	0.331	0.709	2.532E-23	548	0.138	0.316	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
15	AFDB:Q8T145	0.252	0.180	1.009E-14	1789	0.132	0.092	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
16	AFDB:Q8IYD8	0.269	0.172	9.301E-13	2048	0.133	0.081	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
17	AFDB:F4IDQ6	0.155	0.128	3.320E-7	1576	0.143	0.114	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
18	AFDB:Q6DFV5	0.188	0.130	7.420E-5	1964	0.104	0.066	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
19	AFDB:P42694	0.188	0.129	4.148E-4	1942	0.104	0.067	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
20	AFDB:Q385F2	0.062	0.063	7.680E-1	1231	0.089	0.090	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2NKX8	0.0	2584	1250	1.000	1.000	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
2	A0A0P0WGX7	1.30e-141	457	987	0.198	0.250	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
3	Q8W103	4.75e-141	458	1090	0.202	0.232	CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana OX=3702 GN=CHR24 PE=2 SV=1
4	Q03468	9.60e-102	357	1493	0.166	0.139	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
5	F8VPZ5	4.39e-101	355	1481	0.165	0.139	ERCC6_MOUSE DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1
6	A0A0G2JTU1	4.44e-101	354	1474	0.167	0.142	A0A0G2JTU1_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
7	Q9ZV43	3.86e-93	328	1187	0.150	0.158	CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana OX=3702 GN=CHR8 PE=2 SV=1
8	Q9UR24	3.91e-92	321	973	0.157	0.201	RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp26 PE=4 SV=1
9	P40352	8.84e-90	317	1085	0.154	0.178	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
10	Q57UN8	6.59e-80	288	1126	0.166	0.184	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
11	A0A8I6AM82	3.20e-79	283	911	0.152	0.209	A0A8I6AM82_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=1
12	F1LYB7	3.22e-79	282	888	0.152	0.214	F1LYB7_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=2
13	D3ZS47	4.85e-79	288	1325	0.139	0.131	D3ZS47_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
14	Q9Y620	3.25e-78	280	910	0.150	0.207	RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens OX=9606 GN=RAD54B PE=1 SV=1
15	Q6PFE3	7.42e-78	278	886	0.151	0.213	RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus OX=10090 GN=Rad54b PE=2 SV=1
16	Q08773	2.59e-73	268	1120	0.142	0.159	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
17	P41410	2.23e-72	261	852	0.144	0.211	RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp54 PE=1 SV=2
18	A0A0A0MRP6	2.66e-71	261	1058	0.148	0.175	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
19	F1Q8K0	2.74e-71	256	738	0.149	0.252	RAD54_DANRE DNA repair and recombination protein RAD54-like OS=Danio rerio OX=7955 GN=rad54l PE=1 SV=1
20	Q5A310	4.02e-71	261	1056	0.135	0.160	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13872 AAA_34	0.0028	28.2	P-loop containing NTP hydrolase pore-1
2	PF00270 DEAD	0.1	23.9	DEAD/DEAH box helicase
3	PF06733 DEAD_2	1.1e+02	13.8	DEAD_2
4	PF20092 DUF6483	30	16.4	Family of unknown function (DUF6483)
5	PF11496 HDA2-3	1.5	19.5	Class II histone deacetylase complex subunits 2 and 3
6	PF00271 Helicase_C	1.7e-14	65.4	Helicase conserved C-terminal domain
7	PF02562 PhoH	3.9e+02	11.9	PhoH-like protein
8	PF04851 ResIII	3.7e-10	51.6	Type III restriction enzyme, res subunit
9	PF00176 SNF2-rel_dom	4.9e-53	191.7	SNF2-related domain
10	PF18766 SWI2_SNF2	0.031	25.5	SWI2/SNF2 ATPase
11	PF00515 TPR_1	5.5	18.2	Tetratricopeptide repeat
12	PF13414 TPR_11	1.9	19.6	TPR repeat
13	PF07719 TPR_2	4.5	18.7	Tetratricopeptide repeat
14	PF13181 TPR_8	34	16.0	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334675

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
2	9606.ENSP00000378699	0.982	Cyclin-dependent kinase 1
3	9606.ENSP00000256442	0.968	G2/mitotic-specific cyclin-B1
4	9606.ENSP00000317039	0.956	RecQ-mediated genome instability protein 1
5	9606.ENSP00000442336	0.937	DNA topoisomerase 3-alpha
6	9606.ENSP00000347232	0.919	Bloom syndrome protein
7	9606.ENSP00000411268	0.901	BEN domain-containing protein 3
8	9606.ENSP00000363524	0.883	Chromosome-associated kinesin KIF4A
9	9606.ENSP00000296509	0.856	Mitotic spindle assembly checkpoint protein MAD2A
10	9606.ENSP00000251496	0.850	Condensin complex subunit 3
11	9606.ENSP00000418268	0.842	Protein MCM10 homolog
12	9606.ENSP00000411532	0.827	DNA topoisomerase 2-alpha
13	9606.ENSP00000240423	0.811	Condensin complex subunit 2
14	9606.ENSP00000287598	0.811	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
15	9606.ENSP00000324020	0.805	Kinesin-like protein KIF15
16	9606.ENSP00000355506	0.804	Exonuclease 1
17	9606.ENSP00000336868	0.787	Histone H3-like centromeric protein A
18	9606.ENSP00000358813	0.785	Dual specificity protein kinase TTK
19	9606.ENSP00000265148	0.763	Centromere-associated protein E
20	9606.ENSP00000221859	0.759	DNA-directed RNA polymerase II subunit RPB9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0015616	0.838	DNA translocase activity
GO:1901363	0.616	heterocyclic compound binding
GO:0097159	0.610	organic cyclic compound binding
GO:0003676	0.471	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0050896	0.978	response to stimulus
GO:0006259	0.977	DNA metabolic process
GO:0051716	0.969	cellular response to stimulus
GO:0050789	0.968	regulation of biological process
GO:0006950	0.936	response to stress
GO:0006974	0.929	cellular response to DNA damage stimulus
GO:0006310	0.916	DNA recombination
GO:0050794	0.884	regulation of cellular process
GO:0006281	0.835	DNA repair
GO:0060255	0.789	regulation of macromolecule metabolic process
GO:0071840	0.643	cellular component organization or biogenesis
GO:0016043	0.576	cellular component organization
GO:0051171	0.531	regulation of nitrogen compound metabolic process
GO:0080090	0.511	regulation of primary metabolic process
GO:0031323	0.489	regulation of cellular metabolic process
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0006996	0.457	organelle organization
GO:0048518	0.422	positive regulation of biological process
GO:0007049	0.365	cell cycle
GO:0048522	0.346	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0016020	0.987	membrane
GO:0005634	0.977	nucleus
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0032991	0.961	protein-containing complex
GO:0005694	0.627	chromosome
GO:0070013	0.475	intracellular organelle lumen
GO:0005654	0.473	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]