StarFunc result for job id Q2NL67

User Input

>input (630 residues)
MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIRE
YGTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSN
KEGFGLGLQLKKILGMFTSQQWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPI
PKSPSFPIIQDSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVFGYPPSPQAGLLCPQH
VGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSM
LKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPS
VVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW
IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
HSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYN
RMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYED
GQVGDANINTQDPKIQKEIMRVIGTQVYTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V9P8	0.618	0.618	0.000	630	0.987	0.987	G3V9P8.pdb.gz	G3V9P8_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=3
2	AFDB:Q8N3A8	0.465	0.348	1.095E-70	854	0.625	0.461	Q8N3A8.pdb.gz	PARP8_HUMAN Protein mono-ADP-ribosyltransferase PARP8 OS=Homo sapiens OX=9606 GN=PARP8 PE=1 SV=1
3	PDB:6x0lP	0.188	0.245	2.615E-5	474	0.076	0.101	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
4	PDB:1ikpA	0.146	0.152	7.044E-2	599	0.076	0.080	1ikpA.pdb.gz
5	PDB:2nvuC	0.086	0.217	2.724E-1	176	0.019	0.068	2nvuC.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
6	PDB:4q5eC	0.080	0.239	5.503E-1	155	0.010	0.039	4q5eC.pdb.gz
7	PDB:4gskY	0.074	0.209	6.833E-1	137	0.011	0.051	4gskY.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
8	PDB:5a4pA	0.083	0.195	7.614E-1	227	0.010	0.026	5a4pA.pdb.gz
9	PDB:3tgoD	0.100	0.245	9.979E-1	186	0.025	0.086	3tgoD.pdb.gz
10	PDB:1ek9A	0.048	0.062	1.053	428	0.046	0.068	1ek9A.pdb.gz
11	PDB:2uczA	0.080	0.227	1.053	164	0.011	0.043	2uczA.pdb.gz
12	PDB:7meyB	0.084	0.266	1.053	153	0.016	0.065	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
13	AFDB:A4JYL8	0.055	0.068	1.569	475	0.044	0.059	A4JYL8.pdb.gz
14	AFDB:P06668	0.069	0.091	2.170	424	0.059	0.087	P06668.pdb.gz	VIRD2_RHIRD T-DNA border endonuclease VirD2 OS=Rhizobium radiobacter OX=358 GN=virD2 PE=1 SV=1
15	AFDB:Q7Z692	0.060	0.100	2.418	300	0.065	0.137	Q7Z692.pdb.gz	CEA19_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 19 OS=Homo sapiens OX=9606 GN=CEACAM19 PE=2 SV=2
16	AFDB:P51116	0.056	0.054	2.845	673	0.054	0.051	P51116.pdb.gz	FXR2_HUMAN RNA-binding protein FXR2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2
17	AFDB:D3ZDS9	0.053	0.055	3.170	593	0.059	0.062	D3ZDS9.pdb.gz	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
18	AFDB:Q386Y4	0.064	0.068	3.170	570	0.054	0.060	Q386Y4.pdb.gz	Q386Y4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0010 PE=4 SV=1
19	AFDB:P48551	0.055	0.065	3.346	515	0.048	0.058	P48551.pdb.gz	INAR2_HUMAN Interferon alpha/beta receptor 2 OS=Homo sapiens OX=9606 GN=IFNAR2 PE=1 SV=1
20	AFDB:A0A060Y5T9	0.051	0.061	3.728	491	0.032	0.041	A0A060Y5T9.pdb.gz	A0A060Y5T9_ONCMY Cystatin fetuin-B-type domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00022832001 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUL8	0.0	967	474	0.741	0.985	A0A8I5ZUL8_RAT Poly (ADP-ribose) polymerase family, member 6 OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=1
2	A0A8I6A4Q9	0.0	1020	519	0.781	0.948	A0A8I6A4Q9_RAT Poly (ADP-ribose) polymerase family, member 6 OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=1
3	A0A8I6GHS7	0.0	968	520	0.741	0.898	A0A8I6GHS7_RAT Poly (ADP-ribose) polymerase family, member 6 OS=Rattus norvegicus OX=10116 GN=Parp6 PE=4 SV=1
4	A0A8I6GLB1	0.0	913	451	0.705	0.984	A0A8I6GLB1_RAT Poly (ADP-ribose) polymerase family, member 6 OS=Rattus norvegicus OX=10116 GN=Parp6 PE=4 SV=1
5	B2RZ49	0.0	972	473	0.741	0.987	B2RZ49_RAT Parp6 protein OS=Rattus norvegicus OX=10116 GN=Parp6 PE=2 SV=1
6	G3V9P8	0.0	1303	631	0.992	0.990	G3V9P8_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Parp6 PE=3 SV=3
7	Q2NL67	0.0	1316	630	1.000	1.000	PARP6_HUMAN Protein mono-ADP-ribosyltransferase PARP6 OS=Homo sapiens OX=9606 GN=PARP6 PE=1 SV=1
8	Q8N3A8	0.0	584	854	0.470	0.347	PARP8_HUMAN Protein mono-ADP-ribosyltransferase PARP8 OS=Homo sapiens OX=9606 GN=PARP8 PE=1 SV=1
9	Q8N5Y8	6.86e-08	57.0	322	0.111	0.217	PAR16_HUMAN Protein mono-ADP-ribosyltransferase PARP16 OS=Homo sapiens OX=9606 GN=PARP16 PE=1 SV=2
10	Q7TMM8	5.09e-07	54.3	322	0.098	0.193	PAR16_MOUSE Protein mono-ADP-ribosyltransferase PARP16 OS=Mus musculus OX=10090 GN=Parp16 PE=1 SV=2
11	Q57ZY1	0.013	41.2	573	0.040	0.044	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
12	Q54X55	0.014	40.8	804	0.040	0.031	Q54X55_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1B PE=4 SV=1
13	Q8I7C6	0.063	38.9	700	0.033	0.030	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
14	G3V167	0.065	38.5	531	0.041	0.049	G3V167_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=1
15	G3V749	0.066	38.5	558	0.054	0.061	G3V749_RAT Poly (ADP-ribose) polymerase 2 OS=Rattus norvegicus OX=10116 GN=Parp2 PE=3 SV=1
16	Q9UGN5	0.067	38.5	583	0.041	0.045	PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2
17	P35875	0.075	38.5	994	0.056	0.035	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
18	O88554	0.14	37.7	559	0.032	0.036	PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3
19	Q54E42	0.22	37.4	2536	0.038	0.009	Q54E42_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt3 PE=4 SV=1
20	Q9Y6F1	0.28	36.6	533	0.040	0.047	PARP3_HUMAN Protein mono-ADP-ribosyltransferase PARP3 OS=Homo sapiens OX=9606 GN=PARP3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18084 ARTD15_N	0.14	23.8	ARTD15 N-terminal domain
2	PF00644 PARP	9.3e-10	49.9	Poly(ADP-ribose) polymerase catalytic domain
3	PF14260 zf-C4pol	3.9e+02	12.9	C4-type zinc-finger of DNA polymerase delta

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000007340

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000002108	0.710	Poly [ADP-ribose] polymerase
2	43179.ENSSTOP00000017686	0.642	Belongs to the integrin alpha chain family.
3	43179.ENSSTOP00000002296	0.637	Poly (ADP-ribose) polymerase family, member 3
4	43179.ENSSTOP00000012041	0.601	Poly (ADP-ribose) polymerase family, member 9
5	43179.ENSSTOP00000022161	0.590	Poly (ADP-ribose) polymerase family, member 14
6	43179.ENSSTOP00000015831	0.573	Poly (ADP-ribose) polymerase family, member 4
7	43179.ENSSTOP00000010987	0.572	ADP-dependent glucokinase
8	43179.ENSSTOP00000001166	0.554	SUMO1/sentrin specific peptidase 7
9	43179.ENSSTOP00000018175	0.554	Poly (ADP-ribose) polymerase 2
10	43179.ENSSTOP00000012037	0.549	Transmembrane protein 202
11	43179.ENSSTOP00000019632	0.549	Uncharacterized protein
12	43179.ENSSTOP00000021991	0.548	Poly (ADP-ribose) polymerase family, member 11
13	43179.ENSSTOP00000014540	0.547	Olfactory receptor, family 4, subfamily D, member 10
14	43179.ENSSTOP00000016028	0.547	Ariadne RBR E3 ubiquitin protein ligase 1
15	43179.ENSSTOP00000016884	0.547	Protein pelota homolog
16	43179.ENSSTOP00000023334	0.547	Olfactory receptor, family 4, subfamily D, member 11
17	43179.ENSSTOP00000004105	0.546	Poly (ADP-ribose) polymerase family, member 12
18	43179.ENSSTOP00000018924	0.545	Protocadherin gamma subfamily B, 4
19	43179.ENSSTOP00000005642	0.513	Poly (ADP-ribose) polymerase family, member 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity
GO:0005515	0.887	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:1901564	0.966	organonitrogen compound metabolic process
GO:0048522	0.961	positive regulation of cellular process
GO:0043687	0.947	post-translational protein modification
GO:0051128	0.840	regulation of cellular component organization
GO:0010975	0.771	regulation of neuron projection development
GO:0051130	0.750	positive regulation of cellular component organization
GO:0022603	0.749	regulation of anatomical structure morphogenesis
GO:0050773	0.719	regulation of dendrite development
GO:0022604	0.715	regulation of cell morphogenesis
GO:0009987	0.665	cellular process
GO:0051239	0.650	regulation of multicellular organismal process
GO:0051094	0.590	positive regulation of developmental process
GO:0010769	0.587	regulation of cell morphogenesis involved in differentiation
GO:0048814	0.587	regulation of dendrite morphogenesis
GO:0045595	0.573	regulation of cell differentiation
GO:0031346	0.571	positive regulation of cell projection organization
GO:2000026	0.531	regulation of multicellular organismal development
GO:0010770	0.417	positive regulation of cell morphogenesis involved in differentiation
GO:0050767	0.416	regulation of neurogenesis
GO:0051962	0.415	positive regulation of nervous system development
GO:0050775	0.414	positive regulation of dendrite morphogenesis
GO:0044237	0.348	cellular metabolic process
GO:0050896	0.326	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0070013	0.993	intracellular organelle lumen
GO:0005829	0.987	cytosol
GO:0031981	0.979	nuclear lumen
GO:0005654	0.961	nucleoplasm
GO:0043232	0.754	intracellular non-membrane-bounded organelle
GO:0016020	0.418	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.-	1.000	Pentosyltransferases.

[back to server]