StarFunc result for job id Q2PPJ7

User Input

>input (1873 residues)
MFSRRSHGDVKKSTQKVLDPKKDVLTRLKHLRALLDNVDANDLKQFFETNYSQIYFIFYE
NFIALENSLKLKGNNKSQREELDSILFLFEKILQFLPERIFFRWHYQSIGSTLKKLLHTG
NSIKIRCEGIRLFLLWLQALQTNCAEEQVLIFACLVPGFPAVMSSRGPCTLETLINPSPS
VADVKIYPEEITPLLPAISGEKIAEDQTCFFLQILLKYMVIQAASLEWKNKENQDTGFKF
LFTLFRKYYLPHLFPSFTKLTNIYKPVLDIPHLRPKPVYITTTRDNENIYSTKIPYMAAR
VVFIKWIVTFFLEKKYLTATQNTKNGVDVLPKIIQTVGGGAVQERAPELDGGGPTEQDKS
HSNSSTLSDRRLSNSSLCSIEEEHRMVYEMVQRILLSTRGYVNFVNEVFHQAFLLPSCEI
AVTRKVVQVYRKWILQDKPVFMEEPDRKDVAQEDAEKLGFSETDSKEASSESSGHKRSSS
WGRTYSFTSAMSRGCVTEEENTNVKAGVQALLQVFLTNSANIFLLEPCAEVPVLLKEQVD
ACKAVLIIFRRMIMELTMNKKTWEQMLQILLRITEAVMQKPKDKQIKDLFAQSLAGLLFR
TLMVAWIRANLCVYISRELWDDFLGVLSSLTEWEELINEWANIMDSLTAVLARTVYGVEM
TNLPLDKLSEQKEKKQRGKGCVLDPQKGTTVGRSFSLSWRSHPDVTEPMRFRSATTSGAP
GVEKARNIVRQKATEVEECQQSENAPAAGSGHLTVGQQQQVLRSSSTSDIPEPLCSDSSQ
GQKAENTQNSSSSEPQPIQENKGHVKREHEGITILVRRSSSPAELDLKDDLQQTQGKCRE
RQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDASN
LTDSSECLTDDCSIIAGGSLTGWHPDSAAVLWRRVLGILGDVNNIQSPKIHARVFCYLYE
LWYKLAKIRDNLAISLDNQSSPSPPVLIPPLRMFASWLFKAATLPNEYKEGKLQAYRLIC
AMMTRRQDVLPNSDFLVHFYLVMHLGLTSEDQDILNTIIRHCPPRFFSLGFPGFSMLVGD
FITAAARVLSTDILTAPRSEAVTVLGSLVCFPNTYQEIPLLQSVPEVNEAITGTEDVKHY
LINILLKNATEEPNEYARCIAVCSLGVWICEELAQCTSHPQVKEAINVIGVTLKFPNKIV
AQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVATVAFLLPSAEYSSVETDKKFIVSLL
LCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLDYIYRVLHCCVCGSSTYTQQSHYIL
TLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNLLTVEEEKKRRSLELIPLTARMVMA
HLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSELSFEVFRSPNLQLFVFNDSTLISYL
QTPTEGPVGGSPVGSLSDVRVIVRDISGKYSWDGKVLYGPLEGCLAPNGRNPSFLISSWH
RDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEI
IEVILRQNAQEDEYIQSHNFDSAMKVTSQGQPSPVEPRGPFYFCRLLLDDLGMNSWDRRK
NFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIAEGQEDKCSILSNERGSQAYEDFVAG
LGWEVDLSTHCGFMGGLQRNGSTGQTAPYYATSTVEVIFHVSTRMPSDSDDSLTKKLRHL
GNDEVHIVWSEHSRDYRRGIIPTAFGDVSIIIYPMKNHMFFIAITKKPEVPFFGPLFDGA
IVSGKLLPSLVCATCINASRAVKCLIPLYQSFYEERALYLEAIIQNHREVMTFEDFAAQV
FSPSPSYSLSGTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q8N1	0.735	0.643	0.000	2152	0.545	0.474	A0A2R8Q8N1.pdb.gz
2	AFDB:Q2PPJ7	1.000	1.000	0.000	1873	1.000	1.000	Q2PPJ7.pdb.gz	RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2
3	AFDB:Q6GYQ0	0.759	0.701	0.000	2036	0.549	0.505	Q6GYQ0.pdb.gz	RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1
4	AFDB:Q9VW83	0.268	0.271	9.521E-16	1847	0.124	0.126	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
5	PDB:7dl2B	0.270	0.458	9.392E-15	1042	0.077	0.139	7dl2B.pdb.gz
6	PDB:7dl2A	0.244	0.381	1.103E-14	1127	0.076	0.127	7dl2A.pdb.gz
7	AFDB:O43166	0.118	0.121	3.130E-8	1804	0.086	0.089	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
8	AFDB:Q9P2F8	0.114	0.122	6.448E-8	1722	0.042	0.045	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
9	AFDB:Q8C0T5	0.119	0.125	7.274E-8	1782	0.088	0.092	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
10	AFDB:A0A2R8RNK4	0.117	0.125	1.087E-7	1718	0.045	0.049	A0A2R8RNK4.pdb.gz
11	AFDB:O35412	0.109	0.112	3.346E-7	1822	0.086	0.089	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
12	PDB:4a0cA	0.087	0.126	3.481E-4	1155	0.074	0.119	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	AFDB:P38903	0.120	0.262	9.500E-4	757	0.061	0.151	P38903.pdb.gz	2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTS1 PE=1 SV=2
14	PDB:7r5jC0	0.145	0.138	1.880E-3	2011	0.095	0.088	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:7pgsN	0.137	0.142	2.208E-3	1787	0.074	0.078	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
16	PDB:5uwuC	0.113	0.180	2.298E-3	998	0.071	0.133	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
17	PDB:3wyfC	0.122	0.191	2.699E-3	1040	0.074	0.133	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
18	PDB:7mp6B	0.128	0.142	3.044E-3	1609	0.061	0.071	7mp6B.pdb.gz
19	PDB:7mqaSP	0.113	0.090	3.575E-3	2485	0.082	0.062	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6n1zA	0.108	0.173	4.198E-3	961	0.073	0.142	6n1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KGS3	0.0	3558	1872	0.915	0.915	RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus OX=10090 GN=Ralgapa2 PE=1 SV=2
2	H7C1F9	0.0	3511	1740	0.901	0.970	H7C1F9_HUMAN Ral GTPase activating protein catalytic subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=1
3	P86411	0.0	3542	1872	0.911	0.912	RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Ralgapa2 PE=1 SV=1
4	Q2PPJ7	0.0	3890	1873	1.000	1.000	RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2
5	Q6GYP7	0.0	1167	2035	0.316	0.290	RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Ralgapa1 PE=1 SV=1
6	Q6GYQ0	0.0	1168	2036	0.314	0.289	RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1
7	P86409	4.16e-131	415	337	0.108	0.602	RGPA1_PIG Ral GTPase-activating protein subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=RALGAPA1 PE=1 SV=1
8	V6CLC2	2.31e-36	153	1306	0.046	0.066	V6CLC2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-1 PE=1 SV=1
9	Q54VB2	8.24e-29	129	2935	0.043	0.027	Q54VB2_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280527 PE=4 SV=1
10	A0A0G2KHX4	7.30e-22	106	1674	0.036	0.041	A0A0G2KHX4_DANRE TSC complex subunit 2 OS=Danio rerio OX=7955 GN=fc16b02 PE=1 SV=1
11	A0A2R8Y7C8	9.62e-22	105	1782	0.036	0.038	A0A2R8Y7C8_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
12	A0A2R8YGD6	9.75e-22	105	1805	0.036	0.037	A0A2R8YGD6_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
13	A0A2R8YGU4	9.78e-22	105	1739	0.036	0.039	A0A2R8YGU4_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
14	A0A2R8Y5F1	9.86e-22	105	1738	0.036	0.039	A0A2R8Y5F1_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
15	H3BMQ0	3.19e-21	104	1751	0.034	0.037	H3BMQ0_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
16	X5D2U8	3.47e-21	104	1741	0.034	0.037	X5D2U8_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
17	P49815	3.48e-21	104	1807	0.034	0.035	TSC2_HUMAN Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2
18	A0A2R8YDR3	3.49e-21	104	1781	0.034	0.036	A0A2R8YDR3_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
19	X5D7Q2	3.55e-21	104	1740	0.034	0.037	X5D7Q2_HUMAN Tuberous sclerosis 2 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=2 SV=1
20	A0A2R8Y6C9	5.83e-21	103	1359	0.034	0.047	A0A2R8Y6C9_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09420 Nop16	2.3e+02	13.2	Ribosome biogenesis protein Nop16
2	PF20412 RALGAPB_N	1.8e-26	104.0	RALGAPB N-terminal domain
3	PF02145 Rap_GAP	2.8e-41	152.6	Rap/ran-GAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000202677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005257	0.947	Ras-related protein Ral-A
2	9606.ENSP00000262879	0.933	Ral GTPase-activating protein subunit beta
3	9606.ENSP00000375892	0.901	RAC-beta serine/threonine-protein kinase
4	9606.ENSP00000303580	0.755	NF-kappa-B inhibitor-interacting Ras-like protein 2
5	9606.ENSP00000245957	0.655	Cilia- and flagella-associated protein 61
6	9606.ENSP00000456850	0.646	Testicular haploid expressed gene protein-like
7	9606.ENSP00000368589	0.644	Belongs to the Gfo/Idh/MocA family
8	9606.ENSP00000359045	0.630	Rho GTPase-activating protein 4
9	9606.ENSP00000382097	0.613	Doublecortin domain containing 2C
10	9606.ENSP00000255006	0.592	Ras and Rab interactor 2
11	9606.ENSP00000345972	0.566	FYN-binding protein 2
12	9606.ENSP00000249700	0.543	Tropomodulin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.932	molecular function regulator activity
GO:0140677	0.895	molecular function activator activity
GO:0030234	0.884	enzyme regulator activity
GO:0008047	0.870	enzyme activator activity
GO:0060589	0.800	nucleoside-triphosphatase regulator activity
GO:0030695	0.776	GTPase regulator activity
GO:0005096	0.676	GTPase activator activity
GO:0046983	0.514	protein dimerization activity
GO:0046982	0.455	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0043547	0.980	positive regulation of GTPase activity
GO:0090630	0.936	activation of GTPase activity
GO:0050794	0.888	regulation of cellular process
GO:0009987	0.877	cellular process
GO:0050896	0.655	response to stimulus
GO:0051716	0.426	cellular response to stimulus
GO:0007165	0.394	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.935	intracellular membrane-bounded organelle
GO:0016020	0.932	membrane
GO:0071944	0.926	cell periphery
GO:0005886	0.916	plasma membrane
GO:0005634	0.735	nucleus
GO:0070013	0.540	intracellular organelle lumen
GO:0005576	0.431	extracellular region
GO:0031981	0.431	nuclear lumen
GO:0005654	0.403	nucleoplasm
GO:0005615	0.390	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]