StarFunc result for job id Q2Q1W2

User Input

>input (868 residues)
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP
CLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL
DAVVATADEPPPKNGRAGAPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSA
PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER
GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVV
QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSS
GAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEV
SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA
CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR
NHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQS
ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ
MDRPSGIAITPDGMIVVVDFGNNRILVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FAM5	0.735	0.771	0.000	824	0.718	0.756	E7FAM5.pdb.gz	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
2	AFDB:Q2Q1W2	1.000	1.000	0.000	868	1.000	1.000	Q2Q1W2.pdb.gz	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
3	AFDB:Q9U489	0.439	0.345	3.977E-69	1147	0.348	0.263	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
4	AFDB:O70277	0.367	0.420	8.313E-60	744	0.280	0.327	O70277.pdb.gz	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
5	AFDB:E7F1U3	0.345	0.381	1.459E-58	774	0.267	0.300	E7F1U3.pdb.gz	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
6	AFDB:F1QFW2	0.343	0.392	9.167E-58	744	0.267	0.312	F1QFW2.pdb.gz	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
7	AFDB:D3ZQG6	0.360	0.412	4.898E-57	744	0.270	0.315	D3ZQG6.pdb.gz	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
8	AFDB:Q9V4M2	0.304	0.317	1.936E-50	832	0.282	0.294	Q9V4M2.pdb.gz	WECH_DROME Protein wech OS=Drosophila melanogaster OX=7227 GN=wech PE=1 SV=2
9	AFDB:P34611	0.284	0.290	2.236E-36	851	0.200	0.204	P34611.pdb.gz	NCL1_CAEEL B-box type zinc finger protein ncl-1 OS=Caenorhabditis elegans OX=6239 GN=ncl-1 PE=2 SV=1
10	AFDB:Q8MQJ9	0.285	0.240	1.391E-33	1037	0.244	0.204	Q8MQJ9.pdb.gz	BRAT_DROME Brain tumor protein OS=Drosophila melanogaster OX=7227 GN=brat PE=1 SV=2
11	PDB:5c2vB	0.237	0.539	2.089E-11	352	0.039	0.097	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
12	PDB:7zp6A	0.256	0.644	3.050E-11	321	0.058	0.156	7zp6A.pdb.gz
13	PDB:5nnzA	0.215	0.494	3.398E-11	335	0.044	0.113	5nnzA.pdb.gz
14	PDB:5o9zL	0.252	0.451	7.644E-11	459	0.038	0.072	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
15	PDB:5yzgs	0.223	0.483	8.069E-11	374	0.069	0.160	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:7mq8LO	0.215	0.220	2.023E-10	848	0.068	0.070	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8SG	0.223	0.457	2.798E-10	389	0.073	0.162	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3jb9L	0.229	0.608	3.473E-10	293	0.046	0.137	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:6bk8D	0.223	0.483	3.869E-10	359	0.054	0.131	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:4gn7A	0.246	0.660	4.311E-10	297	0.044	0.128	4gn7A.pdb.gz	Structural basis of the gamma-lactone-ring formation in ascorbic acid biosynthesis by the senescence marker protein-30/gluconolactonase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FAM5	0.0	1238	824	0.721	0.760	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
2	Q1PSW8	0.0	1488	855	0.901	0.915	LIN41_MOUSE E3 ubiquitin-protein ligase TRIM71 OS=Mus musculus OX=10090 GN=Trim71 PE=1 SV=1
3	Q2Q1W2	0.0	1779	868	1.000	1.000	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
4	Q9U489	6.81e-135	433	1147	0.342	0.259	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
5	O75382	7.59e-96	318	744	0.247	0.288	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
6	Q9R1R2	6.18e-95	316	744	0.241	0.281	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
7	F1QFW2	2.46e-93	312	744	0.232	0.270	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
8	O70277	3.15e-93	311	744	0.238	0.278	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
9	Q58ER5	5.91e-93	311	744	0.232	0.270	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
10	Q9C040	2.50e-92	309	744	0.226	0.263	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
11	Q9ESN6	3.30e-92	309	744	0.226	0.263	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
12	D3ZQG6	3.81e-92	308	744	0.226	0.263	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
13	E7F1U3	2.48e-76	266	774	0.225	0.252	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
14	Q9V4M2	9.90e-75	263	832	0.152	0.159	WECH_DROME Protein wech OS=Drosophila melanogaster OX=7227 GN=wech PE=1 SV=2
15	B7YZK8	2.50e-60	226	1517	0.131	0.075	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
16	Q7JUV6	3.12e-60	225	1353	0.131	0.084	Q7JUV6_DROME GH06739p OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
17	A0A0B4LFW8	3.92e-60	225	1277	0.131	0.089	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	A0A0B4LFP7	4.02e-60	224	1248	0.131	0.091	A0A0B4LFP7_DROME Thin, isoform D OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
19	Q03601	1.38e-56	213	974	0.136	0.121	NHL1_CAEEL RING finger protein nhl-1 OS=Caenorhabditis elegans OX=6239 GN=nhl-1 PE=1 SV=2
20	P34611	1.07e-44	176	851	0.211	0.215	NCL1_CAEEL B-box type zinc finger protein ncl-1 OS=Caenorhabditis elegans OX=6239 GN=ncl-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17170 DUF5128	3.5e-11	54.5	6-bladed beta-propeller
2	PF18975 DUF5711	1.6e+02	12.9	Family of unknown function (DUF5711)
3	PF00630 Filamin	4.8e-14	64.4	Filamin/ABP280 repeat
4	PF01436 NHL	1.4e-52	184.3	NHL repeat
5	PF08450 SGL	0.00014	33.1	SMP-30/Gluconolactonase/LRE-like region
6	PF00643 zf-B_box	5.4e-10	50.6	B-box zinc finger
7	PF00097 zf-C3HC4	6.8	18.0	Zinc finger, C3HC4 type (RING finger)
8	PF14634 zf-RING_5	3.2	19.1	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.966	Protein argonaute-2
2	9606.ENSP00000363314	0.930	Protein lin-28 homolog A
3	9606.ENSP00000437256	0.898	Endoribonuclease Dicer
4	9606.ENSP00000344401	0.888	Protein lin-28 homolog B
5	9606.ENSP00000446335	0.818	Zinc finger protein 362
6	9606.ENSP00000362300	0.768	Protein argonaute-1
7	9606.ENSP00000380349	0.724	Calpain-3
8	9606.ENSP00000295756	0.678	T-cell receptor-associated transmembrane adapter 1
9	9606.ENSP00000362306	0.674	Protein argonaute-4
10	9606.ENSP00000263182	0.664	Gamma-butyrobetaine dioxygenase
11	9606.ENSP00000403954	0.653	Teneurin-1
12	9606.ENSP00000338173	0.630	Pumilio homolog 2
13	9606.ENSP00000262374	0.616	Chitobiosyldiphosphodolichol beta-mannosyltransferase
14	9606.ENSP00000425979	0.615	Ribonuclease 3
15	9606.ENSP00000382840	0.593	ATP-dependent RNA helicase DDX3X
16	9606.ENSP00000386609	0.567	WD repeat-containing protein 81
17	9606.ENSP00000362287	0.545	Protein argonaute-3
18	9606.ENSP00000316176	0.530	Ubiquitin-conjugating enzyme E2 N
19	9606.ENSP00000419901	0.528	LINE1 type transposase domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035198	1.000	miRNA binding
GO:0030371	0.995	translation repressor activity
GO:0003824	0.891	catalytic activity
GO:0016740	0.781	transferase activity
GO:0140096	0.697	catalytic activity, acting on a protein
GO:0019787	0.669	ubiquitin-like protein transferase activity
GO:0061659	0.650	ubiquitin-like protein ligase activity
GO:0004842	0.623	ubiquitin-protein transferase activity
GO:0061630	0.523	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0050789	0.987	regulation of biological process
GO:0044238	0.984	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0044237	0.980	cellular metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0043170	0.977	macromolecule metabolic process
GO:0016070	0.974	RNA metabolic process
GO:0048518	0.967	positive regulation of biological process
GO:0017148	0.966	negative regulation of translation
GO:0034660	0.950	ncRNA metabolic process
GO:0031047	0.937	RNA-mediated gene silencing
GO:0048522	0.841	positive regulation of cellular process
GO:0019219	0.823	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.784	regulation of RNA metabolic process
GO:0010604	0.781	positive regulation of macromolecule metabolic process
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0045935	0.748	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.552	positive regulation of RNA metabolic process
GO:0010467	0.536	gene expression
GO:0032502	0.489	developmental process
GO:0032501	0.485	multicellular organismal process
GO:0031329	0.463	regulation of cellular catabolic process
GO:0035196	0.417	miRNA processing
GO:0048856	0.396	anatomical structure development
GO:0043487	0.384	regulation of RNA stability
GO:0031331	0.338	positive regulation of cellular catabolic process
GO:0061013	0.337	regulation of mRNA catabolic process
GO:0043488	0.333	regulation of mRNA stability
GO:0050779	0.325	RNA destabilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	0.998	cytoplasmic ribonucleoprotein granule
GO:0000932	0.981	P-body
GO:0043231	0.726	intracellular membrane-bounded organelle
GO:0070013	0.471	intracellular organelle lumen
GO:0031981	0.410	nuclear lumen
GO:0005829	0.388	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.781	Transferases.

[back to server]