StarFunc result for job id Q2QGD7

User Input

>input (858 residues)
MDLPALLPAPTARGGQHGGGPGPLRRAPAPLGASPARRRLLLVRGPEDGGPGARPGEASG
PSPPPAEDDSDGDSFLVLLEVPHGGAAAEAAGSQEAEPGSRVNLASRPEQGPSGPAAPPG
PGVAPAGAVTISSQDLLVRLDRGVLALSAPPGPATAGAAAPRRAPQASGPSTPGYRCPEP
QCALAFAKKHQLKVHLLTHGGGQGRRPFKCPLEGCGWAFTTSYKLKRHLQSHDKLRPFGC
PVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCD
FPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFIC
DSDSCGWTFTSMSKLLRHRRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFEC
PVEGCCARFSARSSLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQ
DLLPQLEAPSSLTPSSELSSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTI
DVTSVSSSLGGNLPANNSSLGPMEPLVLVAHSDIPPSLDSPLVLGTAATVLQQGSFSVDD
VQTVSAGALGCLVALPMKNLSDDPLALTSNSNLAAHITTPTSSSTPRENASVPELLAPIK
VEPDSPSRPGAVGQQEGSHGLPQSTLPSPAEQHGAQDTELSAGTGNFYLESGGSARTDYR
AIQLAKEKKQRGAGSNAGASQSTQRKIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPA
PAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLPVYVLQEVLPSSGGPA
GPEATQFPGSTINLQDLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2QGD7	0.999	0.999	0.000	858	1.000	1.000	Q2QGD7.pdb.gz	ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2
2	AFDB:Q2EI20	0.184	0.185	1.574E-20	855	0.169	0.170	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
3	AFDB:O54963	0.199	0.167	1.921E-18	1069	0.168	0.135	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
4	AFDB:A0A1W2PQA1	0.091	0.075	1.318E-16	1069	0.167	0.134	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
5	AFDB:P15619	0.212	0.210	4.450E-16	869	0.171	0.169	P15619.pdb.gz	SRYC_DROME Serendipity locus protein H-1 OS=Drosophila melanogaster OX=7227 GN=wdn PE=1 SV=2
6	AFDB:P08151	0.128	0.101	2.675E-15	1106	0.211	0.164	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
7	AFDB:P14404	0.166	0.123	3.052E-14	1232	0.178	0.124	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
8	AFDB:P47806	0.128	0.100	7.483E-14	1111	0.182	0.140	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
9	AFDB:F1QAC4	0.130	0.082	1.721E-13	1404	0.199	0.122	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
10	AFDB:Q9HAZ2	0.110	0.079	2.695E-13	1276	0.202	0.136	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
11	PDB:3w5kB	0.067	0.294	3.544E-3	110	0.037	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7b5lH	0.057	0.086	2.280E-1	423	0.047	0.095	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:5tteB	0.049	0.078	5.243E-1	442	0.038	0.075	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:6tutP	0.046	0.115	1.285	196	0.029	0.128	6tutP.pdb.gz	Structural basis for RNA polymerase III transcription repression by Maf1.
15	PDB:7oniH	0.041	0.072	1.285	380	0.028	0.063	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:5apny	0.040	0.119	1.371	211	0.033	0.133	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
17	PDB:6eu0P	0.060	0.116	1.661	298	0.045	0.131	6eu0P.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
18	PDB:5fj9O	0.046	0.065	2.146	528	0.038	0.062	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
19	PDB:6htsR	0.029	0.212	2.146	72	0.020	0.236	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
20	PDB:6o9lQ	0.050	0.083	2.439	430	0.059	0.119	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98168	0.0	773	799	0.535	0.574	ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens OX=9606 GN=ZXDA PE=1 SV=2
2	P98169	0.0	742	803	0.445	0.476	ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens OX=9606 GN=ZXDB PE=1 SV=2
3	Q2QGD7	0.0	1730	858	1.000	1.000	ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2
4	Q9H891	0.0	770	391	0.456	1.000	Q9H891_HUMAN cDNA FLJ13861 fis, clone THYRO1001100, moderately similar to ZINC FINGER X-LINKED PROTEIN ZXDA OS=Homo sapiens OX=9606 PE=1 SV=1
5	P52747	2.20e-40	160	638	0.096	0.129	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
6	O70230	2.67e-39	157	638	0.094	0.127	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
7	Q5XIU2	2.82e-39	157	638	0.094	0.127	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
8	Q9UEG4	1.21e-38	157	869	0.139	0.137	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
9	Q1LYE3	1.42e-38	155	623	0.097	0.133	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
10	P36508	1.86e-38	154	570	0.094	0.142	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
11	Q8BMU0	2.20e-38	153	568	0.094	0.143	ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus OX=10090 GN=Znf76 PE=2 SV=1
12	O88412	2.03e-36	147	524	0.135	0.221	O88412_MOUSE Zinc finger protein 105 OS=Mus musculus OX=10090 GN=Zfp105 PE=2 SV=1
13	Q60821	7.01e-36	148	794	0.113	0.122	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
14	Q13105	9.64e-36	147	803	0.113	0.121	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
15	Q96JL9	1.11e-35	146	665	0.105	0.135	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
16	P17141	1.71e-35	145	594	0.136	0.197	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
17	Q9UJW8	2.02e-35	146	692	0.111	0.137	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
18	M9PD94	2.29e-35	147	907	0.120	0.114	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
19	P51814	4.33e-35	145	821	0.120	0.125	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
20	Q15937	7.53e-35	142	498	0.105	0.181	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	3.6e-27	104.4	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	2.6e-19	79.2	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	22	16.4	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	1.3e-07	43.2	C2H2-type zinc ribbon
5	PF17017 zf-C2H2_aberr	0.0012	30.5	Aberrant zinc-finger
6	PF13465 zf-H2C2_2	1.6e-16	71.1	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485010	0.906	MHC class II transactivator
2	9606.ENSP00000351446	0.747	WD repeat-containing protein 5
3	9606.ENSP00000318177	0.519	Far upstream element-binding protein 3
4	9606.ENSP00000320184	0.513	Mitochondrial ribosomal protein S23
5	9606.ENSP00000244769	0.507	Ataxin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.999	transcription regulator activity
GO:0003713	0.950	transcription coactivator activity
GO:0019904	0.936	protein domain specific binding
GO:0030275	0.920	LRR domain binding
GO:0003676	0.859	nucleic acid binding
GO:0003677	0.694	DNA binding
GO:0070742	0.565	C2H2 zinc finger domain binding
GO:0000976	0.331	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0010468	0.972	regulation of gene expression
GO:0031323	0.956	regulation of cellular metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0051252	0.928	regulation of RNA metabolic process
GO:0006355	0.915	regulation of DNA-templated transcription
GO:0009893	0.812	positive regulation of metabolic process
GO:0010604	0.797	positive regulation of macromolecule metabolic process
GO:0045893	0.775	positive regulation of DNA-templated transcription
GO:0009987	0.648	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.970	cytoplasm
GO:0005829	0.724	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]