StarFunc result for job id Q2QL34

User Input

>input (196 residues)
MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRRVATLVVTFHA
NFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFLDLKQ
KFWNTYLSGLMYWPFVQLTNFSLVPVQWRTAYAGVCGFLWATFICFSQQSGDGTFKSAFT
ILYTKGTSATEGYPKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2QL34	1.000	1.000	5.776E-27	196	1.000	1.000	Q2QL34.pdb.gz	MP17L_HUMAN Mpv17-like protein OS=Homo sapiens OX=9606 GN=MPV17L PE=1 SV=1
2	AFDB:Q99MS3	0.843	0.851	5.379E-20	194	0.776	0.784	Q99MS3.pdb.gz	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
3	AFDB:O14142	0.763	0.728	2.185E-7	206	0.245	0.233	O14142.pdb.gz	SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sym1 PE=3 SV=1
4	AFDB:Q9VN75	0.766	0.777	2.631E-7	193	0.224	0.228	Q9VN75.pdb.gz	Q9VN75_DROME IP08061p OS=Drosophila melanogaster OX=7227 GN=plh PE=2 SV=2
5	AFDB:P42925	0.775	0.782	3.993E-7	194	0.173	0.175	P42925.pdb.gz	PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus OX=10090 GN=Pxmp2 PE=1 SV=2
6	AFDB:P19258	0.727	0.803	5.787E-7	176	0.270	0.301	P19258.pdb.gz	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
7	AFDB:Q567V2	0.695	0.664	6.651E-7	206	0.250	0.238	Q567V2.pdb.gz	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
8	AFDB:Q5TZ51	0.714	0.784	1.058E-6	177	0.240	0.266	Q5TZ51.pdb.gz	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
9	AFDB:Q9NR77	0.765	0.769	1.273E-6	195	0.199	0.200	Q9NR77.pdb.gz	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
10	AFDB:Q8VIK2	0.700	0.687	1.933E-6	200	0.260	0.255	Q8VIK2.pdb.gz	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
11	PDB:6ibbA	0.262	0.191	7.139E-1	301	0.168	0.110	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
12	PDB:6c6lH	0.142	0.170	8.205E-1	160	0.138	0.169	6c6lH.pdb.gz
13	PDB:7uw9i	0.198	0.237	9.877E-1	156	0.097	0.122	7uw9i.pdb.gz
14	PDB:4ntaA	0.181	0.219	1.499	147	0.122	0.163	4ntaA.pdb.gz
15	PDB:7khro	0.182	0.222	1.723	151	0.117	0.152	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
16	PDB:6f7hD	0.182	0.146	1.805	256	0.173	0.133	6f7hD.pdb.gz	Human adipose glycerol flux is regulated by a pH gate in AQP10.
17	PDB:2witA	0.146	0.070	1.891	531	0.138	0.051	2witA.pdb.gz
18	PDB:5zugA	0.179	0.190	1.891	182	0.122	0.132	5zugA.pdb.gz
19	PDB:7xp4R	0.254	0.197	1.980	299	0.128	0.084	7xp4R.pdb.gz
20	PDB:3aouA	0.152	0.185	2.074	156	0.112	0.141	3aouA.pdb.gz	Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2QL34	1.87e-145	404	196	1.000	1.000	MP17L_HUMAN Mpv17-like protein OS=Homo sapiens OX=9606 GN=MPV17L PE=1 SV=1
2	Q99MS3	1.95e-110	315	194	0.776	0.784	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
3	Q5TZ51	3.69e-18	80.1	177	0.245	0.271	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
4	P19258	1.53e-17	78.2	176	0.270	0.301	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
5	P39210	1.29e-16	75.9	176	0.255	0.284	MPV17_HUMAN Protein Mpv17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1
6	Q8VIK2	8.43e-15	71.6	200	0.240	0.235	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
7	Q567V2	1.08e-14	71.2	206	0.240	0.228	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
8	Q9VN75	3.21e-14	69.7	193	0.199	0.202	Q9VN75_DROME IP08061p OS=Drosophila melanogaster OX=7227 GN=plh PE=2 SV=2
9	Q06563	1.51e-13	68.2	197	0.230	0.228	SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYM1 PE=1 SV=1
10	O14142	1.93e-11	62.4	206	0.179	0.170	SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sym1 PE=3 SV=1
11	Q07066	1.69e-07	51.6	194	0.189	0.191	PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Pxmp2 PE=1 SV=2
12	P42925	2.82e-07	50.8	194	0.179	0.180	PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus OX=10090 GN=Pxmp2 PE=1 SV=2
13	Q9SJH9	9.78e-07	49.7	232	0.148	0.125	Q9SJH9_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g42770 PE=1 SV=2
14	Q10244	1.21e-06	49.3	221	0.138	0.122	YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.14 PE=3 SV=1
15	Q9LV46	2.85e-06	48.5	235	0.173	0.145	Q9LV46_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=1 SV=1
16	F4K2L8	1.96e-04	43.1	288	0.133	0.090	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
17	Q9NR77	2.03e-04	42.7	195	0.209	0.210	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
18	Q08743	5.91e-04	42.0	309	0.122	0.078	YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR292C PE=1 SV=1
19	Q9W0B2	0.054	35.8	191	0.153	0.157	Q9W0B2_DROME LD19311p OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.268 PE=1 SV=1
20	A0A0S0WGR0	0.058	35.8	255	0.153	0.118	A0A0S0WGR0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.268 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04117 Mpv17_PMP22	3.6e-16	70.4	Mpv17 / PMP22 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369383	0.826	Protein Mpv17
2	9606.ENSP00000469836	0.826	Mpv17-like protein 2
3	9606.ENSP00000255759	0.691	LisH domain-containing protein FOPNL
4	9606.ENSP00000379654	0.653	Meiosis regulator and mRNA stability factor 1
5	9606.ENSP00000480401	0.572	Zinc finger protein 205
6	9606.ENSP00000205557	0.520	Multidrug resistance-associated protein 6
7	9606.ENSP00000300006	0.520	Uncharacterized protein C16orf45
8	9606.ENSP00000370908	0.517	Protein LOC101930008
9	9606.ENSP00000382274	0.517	Nodal modulator 3
10	9606.ENSP00000379643	0.506	Nuclear distribution protein nudE homolog 1
11	9606.ENSP00000428402	0.501	Clavesin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006996	0.987	organelle organization
GO:0007005	0.983	mitochondrion organization
GO:0031323	0.979	regulation of cellular metabolic process
GO:0006810	0.975	transport
GO:0048523	0.970	negative regulation of cellular process
GO:0008152	0.958	metabolic process
GO:0006839	0.887	mitochondrial transport
GO:0044237	0.886	cellular metabolic process
GO:0090559	0.862	regulation of membrane permeability
GO:0033043	0.841	regulation of organelle organization
GO:0010821	0.822	regulation of mitochondrion organization
GO:0007006	0.703	mitochondrial membrane organization
GO:0010639	0.658	negative regulation of organelle organization
GO:0010823	0.608	negative regulation of mitochondrion organization
GO:0009889	0.452	regulation of biosynthetic process
GO:0023051	0.438	regulation of signaling
GO:0032879	0.436	regulation of localization
GO:0051049	0.433	regulation of transport
GO:0031326	0.415	regulation of cellular biosynthetic process
GO:0048583	0.409	regulation of response to stimulus
GO:0046902	0.360	regulation of mitochondrial membrane permeability
GO:0043067	0.349	regulation of programmed cell death
GO:0042981	0.339	regulation of apoptotic process
GO:0009892	0.328	negative regulation of metabolic process
GO:0010646	0.327	regulation of cell communication
GO:0080090	0.307	regulation of primary metabolic process
GO:0060255	0.300	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0042579	0.935	microbody
GO:0016020	0.829	membrane
GO:0005739	0.742	mitochondrion
GO:0005777	0.668	peroxisome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]