StarFunc result for job id Q2T9J0

User Input

>input (566 residues)
MRRQWGSAMRAAEQAGCMVSASRAGQPEAGPWSCSGVILSRSPGLVLCHGGIFVPFLRAG
SEVLTAAGAVFLPGDSCRDDLRLHVQWAPTAAGPGGGAERGRPGLCTPQCASLEPGPPAP
SRGRPLQPRLPAELLLLLSCPAFWAHFARLFGDEAAEQWRFSSAARDDEVSEDEEADQLR
ALGWFALLGVRLGQEEVEEERGPAMAVSPLGAVPKGAPLLVCGSPFGAFCPDIFLNTLSC
GVLSNVAGPLLLTDARCLPGTEGGGVFTARPAGALVALVVAPLCWKAGEWVGFTLLCAAA
PLFRAARDALHRLPHSTAALAALLPPEVGVPWGLPLRDSGPLWAAAAVLVECGTVWGSGV
AVAPRLVVTCRHVSPREAARVLVRSTTPKSVAIWGRVVFATQETCPYDIAVVSLEEDLDD
VPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAVHSGS
SGGPLFSNHSGNLLGIITSNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTQDLGGLRE
LDRAAEPVRVVWRLQRPLAEAPRSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2T9J0	1.000	1.000	0.000	566	1.000	1.000	Q2T9J0.pdb.gz	TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens OX=9606 GN=TYSND1 PE=1 SV=3
2	AFDB:Q9DBA6	0.970	0.966	4.344E-100	568	0.797	0.794	Q9DBA6.pdb.gz	TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus OX=10090 GN=Tysnd1 PE=1 SV=1
3	AFDB:Q8VZD4	0.725	0.587	2.137E-34	709	0.272	0.217	Q8VZD4.pdb.gz	DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=DEG15 PE=1 SV=2
4	AFDB:Q2L4Q9	0.271	0.277	7.396E-14	553	0.170	0.174	Q2L4Q9.pdb.gz	PRS53_HUMAN Serine protease 53 OS=Homo sapiens OX=9606 GN=PRSS53 PE=1 SV=1
5	AFDB:P69525	0.274	0.153	1.880E-13	1065	0.145	0.077	P69525.pdb.gz	TMPS9_MOUSE Transmembrane protease serine 9 OS=Mus musculus OX=10090 GN=Tmprss9 PE=3 SV=1
6	AFDB:Q5K4E3	0.254	0.177	5.631E-13	855	0.143	0.095	Q5K4E3.pdb.gz	POLS2_HUMAN Polyserase-2 OS=Homo sapiens OX=9606 GN=PRSS36 PE=1 SV=2
7	PDB:3gdvA	0.286	0.525	8.189E-13	296	0.092	0.176	3gdvA.pdb.gz	OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
8	AFDB:P53920	0.253	0.153	1.597E-12	997	0.118	0.067	P53920.pdb.gz	NM111_YEAST Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA111 PE=1 SV=1
9	AFDB:D0ZY51	0.289	0.447	2.345E-12	356	0.101	0.160	D0ZY51.pdb.gz	DEGS_SALT1 Serine endoprotease DegS OS=Salmonella typhimurium (strain 14028s / SGSC 2262) OX=588858 GN=degS PE=3 SV=1
10	AFDB:O74325	0.251	0.151	1.151E-11	997	0.150	0.085	O74325.pdb.gz	YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1685.05 PE=4 SV=1
11	AFDB:O22609	0.274	0.347	1.690E-11	439	0.097	0.125	O22609.pdb.gz	DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP1 PE=1 SV=2
12	PDB:7co5H	0.267	0.449	2.085E-11	325	0.087	0.151	7co5H.pdb.gz	Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
13	PDB:4a8cA	0.292	0.411	2.326E-11	395	0.087	0.124	4a8cA.pdb.gz
14	PDB:1te0A	0.282	0.479	3.239E-10	318	0.088	0.157	1te0A.pdb.gz
15	PDB:3pv2B	0.263	0.374	5.023E-10	388	0.092	0.134	3pv2B.pdb.gz
16	PDB:5t69A	0.256	0.490	9.186E-10	284	0.090	0.180	5t69A.pdb.gz
17	PDB:1tonA	0.280	0.654	1.874E-9	227	0.069	0.172	1tonA.pdb.gz	Rat submaxillary gland serine protease, tonin. Structure solution and refinement at 1.8 A resolution.
18	PDB:3mh5A	0.258	0.695	2.092E-9	191	0.083	0.246	3mh5A.pdb.gz	HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
19	PDB:1spjA	0.278	0.612	4.763E-9	236	0.058	0.140	1spjA.pdb.gz	1.70 A X-ray structure of human apo kallikrein 1: Structural changes upon peptide inhibitor/substrate binding
20	PDB:6nvbB	0.279	0.654	5.032E-9	224	0.058	0.147	6nvbB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2T9J0	0.0	1118	566	1.000	1.000	TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens OX=9606 GN=TYSND1 PE=1 SV=3
2	Q9DBA6	0.0	857	568	0.799	0.796	TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus OX=10090 GN=Tysnd1 PE=1 SV=1
3	Q8VZD4	5.72e-18	90.1	709	0.117	0.093	DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=DEG15 PE=1 SV=2
4	F8W672	1.47e-05	50.1	434	0.095	0.124	F8W672_9GAMM DegQ OS=Legionella fallonii OX=96230 PE=1 SV=2
5	P0AEE3	3.94e-04	45.4	355	0.090	0.144	DEGS_ECOLI Serine endoprotease DegS OS=Escherichia coli (strain K12) OX=83333 GN=degS PE=1 SV=1
6	Q9FL12	5.30e-04	45.4	592	0.095	0.091	DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana OX=3702 GN=DEGP9 PE=1 SV=1
7	D0ZY51	7.62e-04	44.3	356	0.090	0.143	DEGS_SALT1 Serine endoprotease DegS OS=Salmonella typhimurium (strain 14028s / SGSC 2262) OX=588858 GN=degS PE=3 SV=1
8	O82261	0.021	40.0	607	0.072	0.068	DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP2 PE=1 SV=2
9	O22609	0.059	38.5	439	0.080	0.103	DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP1 PE=1 SV=2
10	P0C0V0	0.14	37.4	474	0.057	0.068	DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) OX=83333 GN=degP PE=1 SV=1
11	P39099	0.17	37.0	455	0.083	0.103	DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ OS=Escherichia coli (strain K12) OX=83333 GN=degQ PE=1 SV=1
12	G3XD20	0.24	36.6	474	0.051	0.061	G3XD20_PSEAE Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mucD PE=4 SV=1
13	Q57155	0.24	36.6	474	0.051	0.061	Q57155_PSEAI Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas aeruginosa OX=287 GN=mucD PE=4 SV=1
14	Q9HVX1	0.26	36.6	389	0.067	0.098	Q9HVX1_PSEAE Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algW PE=1 SV=1
15	Q9LU10	0.38	35.8	448	0.060	0.076	DEGP8_ARATH Protease Do-like 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP8 PE=1 SV=1
16	P11034	0.47	35.0	246	0.048	0.110	MCPT1_MOUSE Mast cell protease 1 OS=Mus musculus OX=10090 GN=Mcpt1 PE=1 SV=2
17	Q6IQ20	0.69	35.0	393	0.030	0.043	NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens OX=9606 GN=NAPEPLD PE=1 SV=2
18	Q6GMI0	0.73	35.0	479	0.071	0.084	HTR1A_DANRE Serine protease HTRA1A OS=Danio rerio OX=7955 GN=htra1a PE=2 SV=1
19	Q9C776	1.5	34.3	605	0.037	0.035	ATE2_ARATH Arginyl-tRNA--protein transferase 2 OS=Arabidopsis thaliana OX=3702 GN=ATE2 PE=2 SV=1
20	F1LPL5	2.0	33.1	249	0.080	0.181	F1LPL5_RAT Mast cell protease 1-like 3 OS=Rattus norvegicus OX=10116 GN=Mcpt1l4 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08995 NIP_1	3.6e+02	13.0	Necrosis inducing protein-1
2	PF00089 Trypsin	0.00045	31.6	Trypsin
3	PF13365 Trypsin_2	4.2e-19	81.5	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287078

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.982	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000333664	0.981	3-ketoacyl-CoA thiolase, peroxisomal
3	9606.ENSP00000285737	0.973	Lon protease homolog 2, peroxisomal
4	9606.ENSP00000264167	0.959	Alkyldihydroxyacetonephosphate synthase, peroxisomal
5	9606.ENSP00000380251	0.946	Nucleoside diphosphate-linked moiety X motif 19
6	9606.ENSP00000360569	0.944	Non-specific lipid-transfer protein
7	9606.ENSP00000420914	0.944	Peroxisomal multifunctional enzyme type 2
8	9606.ENSP00000323811	0.941	2-hydroxyacyl-CoA lyase 1
9	9606.ENSP00000391601	0.934	Peroxisomal targeting signal 1 receptor
10	9606.ENSP00000430269	0.932	Bifunctional epoxide hydrolase 2
11	9606.ENSP00000307697	0.931	Peroxisomal acyl-coenzyme A oxidase 2
12	9606.ENSP00000302620	0.930	Alanine-glyoxylate aminotransferase
13	9606.ENSP00000241052	0.929	Catalase
14	9606.ENSP00000263038	0.929	Phytanoyl-CoA dioxygenase, peroxisomal
15	9606.ENSP00000355607	0.928	Glyceronephosphate O-acyltransferase
16	9606.ENSP00000369461	0.928	Enoyl-CoA delta isomerase 2, mitochondrial
17	9606.ENSP00000315013	0.927	Carnitine O-acetyltransferase
18	9606.ENSP00000348775	0.922	Peroxisomal acyl-coenzyme A oxidase 3
19	9606.ENSP00000371517	0.917	Alpha-methylacyl-CoA racemase
20	9606.ENSP00000265322	0.916	Peroxisomal trans-2-enoyl-CoA reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	1.000	serine-type endopeptidase activity
GO:0005515	0.999	protein binding
GO:0042802	0.979	identical protein binding
GO:0002020	0.921	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0009894	0.986	regulation of catabolic process
GO:0019216	0.983	regulation of lipid metabolic process
GO:0051604	0.982	protein maturation
GO:0062012	0.977	regulation of small molecule metabolic process
GO:0010565	0.965	regulation of cellular ketone metabolic process
GO:0046320	0.960	regulation of fatty acid oxidation
GO:0016485	0.942	protein processing
GO:0031329	0.890	regulation of cellular catabolic process
GO:0050994	0.888	regulation of lipid catabolic process
GO:0009987	0.414	cellular process
GO:0044237	0.359	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005782	0.999	peroxisomal matrix
GO:0005829	0.990	cytosol
GO:0016020	0.980	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]