StarFunc result for job id Q2TAA5

User Input

>input (492 residues)
MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK
NQMVIAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRF
NIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAF
TLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLF
AFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPG
HLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDDELRVNQLRRL
SEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG
GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFE
VTFLSSVEKLFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TAA5	1.000	1.000	1.453E-91	492	1.000	1.000	Q2TAA5.pdb.gz	ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
2	AFDB:Q9XEE9	0.859	0.911	6.454E-53	463	0.417	0.443	Q9XEE9.pdb.gz	ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG11 PE=1 SV=2
3	AFDB:Q54DM9	0.917	0.894	1.155E-52	505	0.474	0.461	Q54DM9.pdb.gz	ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg11 PE=3 SV=1
4	AFDB:O74878	0.859	0.896	2.111E-47	471	0.398	0.416	O74878.pdb.gz	ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg11 PE=3 SV=1
5	AFDB:Q38E70	0.848	0.886	2.457E-41	470	0.337	0.353	Q38E70.pdb.gz	Q38E70_TRYB2 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0860 PE=3 SV=1
6	AFDB:P53954	0.822	0.742	6.870E-38	548	0.343	0.308	P53954.pdb.gz	ALG11_YEAST GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG11 PE=1 SV=1
7	AFDB:F1QPS1	0.640	0.686	7.113E-22	455	0.213	0.231	F1QPS1.pdb.gz	F1QPS1_DANRE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Danio rerio OX=7955 GN=im:7145131 PE=1 SV=1
8	AFDB:Q7KWM5	0.637	0.733	9.268E-22	420	0.181	0.212	Q7KWM5.pdb.gz	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
9	AFDB:P43636	0.636	0.624	2.815E-21	503	0.205	0.201	P43636.pdb.gz	ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG2 PE=1 SV=2
10	AFDB:Q96WW6	0.634	0.618	4.532E-21	506	0.201	0.196	Q96WW6.pdb.gz	ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg2 PE=3 SV=2
11	PDB:5hutA	0.582	0.607	1.631E-14	469	0.165	0.173	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
12	PDB:2wtxD	0.576	0.614	1.587E-13	457	0.122	0.131	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
13	PDB:5hvmB	0.573	0.617	2.840E-13	452	0.130	0.142	5hvmB.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
14	PDB:3s27H	0.577	0.376	2.620E-12	797	0.144	0.089	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
15	PDB:5hvoA	0.580	0.617	9.835E-12	459	0.126	0.135	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
16	PDB:2iv7A	0.524	0.674	1.760E-11	370	0.128	0.170	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
17	PDB:3okaA	0.519	0.655	4.561E-11	378	0.152	0.198	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
18	PDB:4pqgA	0.543	0.530	1.063E-10	506	0.134	0.130	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
19	PDB:7q0bB	0.573	0.470	1.540E-10	623	0.132	0.104	7q0bB.pdb.gz
20	PDB:3nb0C	0.565	0.450	4.209E-10	646	0.114	0.087	3nb0C.pdb.gz	Structural basis for glucose-6-phosphate activation of glycogen synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TAA5	0.0	1018	492	1.000	1.000	ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
2	Q54DM9	1.23e-142	421	505	0.457	0.446	ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg11 PE=3 SV=1
3	Q9XEE9	4.67e-137	405	463	0.407	0.432	ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG11 PE=1 SV=2
4	O74878	2.01e-117	355	471	0.404	0.423	ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg11 PE=3 SV=1
5	P53954	7.48e-88	281	548	0.311	0.279	ALG11_YEAST GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG11 PE=1 SV=1
6	Q38E70	9.45e-84	268	470	0.329	0.345	Q38E70_TRYB2 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0860 PE=3 SV=1
7	F1QPS1	6.19e-14	76.3	455	0.152	0.165	F1QPS1_DANRE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Danio rerio OX=7955 GN=im:7145131 PE=1 SV=1
8	Q6FJJ9	1.16e-11	68.9	458	0.222	0.238	ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ALG2 PE=3 SV=1
9	Q9VZU8	1.35e-11	68.6	424	0.120	0.139	Q9VZU8_DROME Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Drosophila melanogaster OX=7227 GN=Alg2 PE=1 SV=1
10	Q95SA2	1.52e-11	68.6	424	0.120	0.139	Q95SA2_DROME Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Drosophila melanogaster OX=7227 GN=Alg2 PE=2 SV=1
11	Q9H553	8.13e-11	66.2	416	0.142	0.168	ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
12	P43636	1.21e-10	65.9	503	0.222	0.217	ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG2 PE=1 SV=2
13	Q7KWM5	2.21e-09	61.6	420	0.167	0.195	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
14	Q96WW6	3.11e-08	58.5	506	0.146	0.142	ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg2 PE=3 SV=2
15	P9WMY7	4.31e-08	57.8	480	0.130	0.133	MSHA_MYCTU D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshA PE=1 SV=1
16	A0R043	1.73e-06	52.4	382	0.100	0.128	PIMB_MYCS2 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimB PE=1 SV=1
17	P9WMZ3	1.04e-04	47.0	385	0.096	0.122	PIMB_MYCTU GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimB PE=1 SV=1
18	A7TZT2	4.40e-04	45.1	454	0.067	0.073	MFPS_AGRFC Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
19	Q9HUG1	0.001	43.5	378	0.100	0.130	Q9HUG1_PSEAE Probable glycosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5004 PE=4 SV=1
20	P9WMY5	0.016	40.0	378	0.047	0.061	MGTA_MYCTU GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mgtA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15924 ALG11_N	3.5e-88	306.7	ALG11 mannosyltransferase N-terminus
2	PF02350 Epimerase_2	6.2e+02	10.6	UDP-N-acetylglucosamine 2-epimerase
3	PF00534 Glycos_transf_1	2.3e-24	97.4	Glycosyl transferases group 1
4	PF13524 Glyco_trans_1_2	2.2	20.1	Glycosyl transferases group 1
5	PF13692 Glyco_trans_1_4	9.7e-12	56.8	Glycosyl transferases group 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430236

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380793	0.987	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
2	9606.ENSP00000296292	0.963	Protein RFT1 homolog
3	9606.ENSP00000262374	0.955	Chitobiosyldiphosphodolichol beta-mannosyltransferase
4	9606.ENSP00000417764	0.943	Alpha-1,3/1,6-mannosyltransferase ALG2
5	9606.ENSP00000378260	0.883	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
6	9606.ENSP00000359224	0.878	UDP-N-acetylglucosamine transferase subunit ALG14 homolog
7	9606.ENSP00000360149	0.874	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
8	9606.ENSP00000386597	0.872	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
9	9606.ENSP00000333813	0.863	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
10	9606.ENSP00000299626	0.846	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
11	9606.ENSP00000274382	0.824	Protein limb expression 1 homolog
12	9606.ENSP00000482396	0.824	Alpha-1,2-mannosyltransferase ALG9
13	9606.ENSP00000482437	0.824	Mannosyltransferase
14	9606.ENSP00000268261	0.816	Phosphomannomutase 2
15	9606.ENSP00000410964	0.816	Erlin-1
16	9606.ENSP00000350704	0.812	Uncharacterized protein C1orf109
17	9606.ENSP00000239891	0.810	ALG5, dolichyl-phosphate beta-glucosyltransferase
18	9606.ENSP00000266483	0.771	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
19	9606.ENSP00000310120	0.765	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
20	9606.ENSP00000478070	0.755	CWC25 spliceosome associated protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000026	1.000	alpha-1,2-mannosyltransferase activity
GO:0008194	0.590	UDP-glycosyltransferase activity
GO:0005488	0.577	binding
GO:0005515	0.449	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006486	0.999	protein glycosylation
GO:0044255	0.996	cellular lipid metabolic process
GO:0006487	0.976	protein N-linked glycosylation
GO:0006490	0.967	oligosaccharide-lipid intermediate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]