StarFunc result for job id Q2TAC2

User Input

>input (915 residues)
MLPLGSEPALNELLLRKEEEWRALQAHRTQLQEAALQDTRSQLEEAQGKLRCLQEDFVYN
LQVLEERDLELERYDAAFAQAREWEEARRAEVSELKIEAAKLRQALAREARKVEELQQQQ
QLAFQEHRLELERVHSDKNGEIDHHREQYENLKWTLERKLEELDGELALQRQELLLEFES
KMRKREHEFRLQADNMSNTALSRELKVKLLHKELEALKEAGAKAAESLQRAEATNAELER
KLQSRAGELQDLEAMSRARVKDLEDKLHSVQLTRKKEEETFKRKHEELDRLAREKDAVLV
AVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDASTVK
SAWDAQIAQLSKEMVSRDLQIQTLQEEEVKLKAQVARSQQDIERYKQQLSLAVERERSLE
RDQVQLGLDWQRRCDDIERDQIQKSEALIQGLSMAKSQVAAKLQETEQALQEQEVVLKAV
TLERDQAVQALRMHGLPRPGAQMLLRQHEEEISKDFPSSEIQRLREQNTSLRNAIAQMRK
EMEALSHQIPPPIQTAAESTDANQPDPEAGGDAATPDYVLALEAEIRTLKHKFKTLEKHL
EDVLDPLKMSSPHAESQPSVRTSTETTGGSAQAGQAGGSVQAGQAGGSVQAGPVSSGLAL
RKLGDRVQLLNLLVTRLRQKVLREPLEPAALQRELPREVDQVHLEVLELRKQVAELGKHL
RIAQHGGAEPSGRKQPPASDAVALGREDAKSAEDEAPSRHLGKHQPRSAQVGSRLDALQG
PKTQHSIHTVTCKSPRQKEDRSPKPPQAPQHPEEHGRQSHSSSSFASGTLQDMWRLLDLG
SSPSGVTSQGDSTPELPAPPAADRRPVKMQAGIATPGMKTAAQAKAKTTGASRSHPAKAK
GCQRPPKIRNYNIMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TAC2	0.999	0.999	0.000	915	1.000	1.000	Q2TAC2.pdb.gz	CCD57_HUMAN Coiled-coil domain-containing protein 57 OS=Homo sapiens OX=9606 GN=CCDC57 PE=1 SV=3
2	AFDB:Q6PHN1	0.192	0.176	1.714E-71	1016	0.622	0.560	Q6PHN1.pdb.gz	CCD57_MOUSE Coiled-coil domain-containing protein 57 OS=Mus musculus OX=10090 GN=Ccdc57 PE=1 SV=1
3	AFDB:Q387K6	0.161	0.176	9.537E-9	821	0.154	0.172	Q387K6.pdb.gz	Q387K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0690 PE=4 SV=1
4	AFDB:Q69ZW5	0.076	0.063	1.778E-7	1140	0.167	0.134	Q69ZW5.pdb.gz	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
5	AFDB:Q4GYI3	0.103	0.104	2.050E-7	912	0.162	0.162	Q4GYI3.pdb.gz	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
6	AFDB:M9PCR7	0.109	0.087	3.146E-7	1205	0.174	0.132	M9PCR7.pdb.gz	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
7	AFDB:Q32PN7	0.115	0.135	3.896E-7	756	0.133	0.161	Q32PN7.pdb.gz	DZI1L_DANRE Cilium assembly protein DZIP1L OS=Danio rerio OX=7955 GN=dzip1l PE=2 SV=1
8	AFDB:B8QI36	0.111	0.090	9.172E-7	1187	0.156	0.120	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
9	AFDB:P08553	0.117	0.123	9.851E-7	848	0.119	0.129	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
10	AFDB:P41046	0.049	0.079	1.136E-6	550	0.096	0.160	P41046.pdb.gz	CORTO_DROME Centrosomal and chromosomal factor OS=Drosophila melanogaster OX=7227 GN=corto PE=1 SV=2
11	PDB:7rroD6	0.067	0.172	2.718	319	0.020	0.056	7rroD6.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7rroD1	0.067	0.135	3.616	425	0.020	0.042	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7rroB1	0.068	0.139	3.884	416	0.019	0.041	7rroB1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:2kn6A	0.027	0.072	4.811	195	0.019	0.087	2kn6A.pdb.gz
15	PDB:7ungD3	0.065	0.169	5.166	317	0.019	0.054	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:3qf4B	0.052	0.075	6.873	588	0.009	0.014	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
17	PDB:6mzcM	0.042	0.223	6.873	104	0.015	0.135	6mzcM.pdb.gz
18	PDB:4cc9B	0.043	0.276	9.142	98	0.013	0.122	4cc9B.pdb.gz	Structural Basis of Lentiviral Subversion of a Cellular Protein Degradation Pathway.
19	PDB:5ganG	0.041	0.091	9.142	318	0.030	0.085	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TAC2	0.0	1823	915	1.000	1.000	CCD57_HUMAN Coiled-coil domain-containing protein 57 OS=Homo sapiens OX=9606 GN=CCDC57 PE=1 SV=3
2	Q6PHN1	0.0	864	1016	0.532	0.479	CCD57_MOUSE Coiled-coil domain-containing protein 57 OS=Mus musculus OX=10090 GN=Ccdc57 PE=1 SV=1
3	E7EY31	8.00e-126	407	1022	0.285	0.255	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
4	Q8IDX6	0.002	44.3	3130	0.055	0.016	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
5	Q07718	0.008	42.4	725	0.087	0.110	Q07718_CHICK ES/130 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q6P9Q6	0.66	36.2	1216	0.059	0.044	FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX=10090 GN=Fkbp15 PE=1 SV=2
7	R4GDZ5	0.91	35.8	1938	0.080	0.038	R4GDZ5_DANRE Myosin, heavy chain 7B, cardiac muscle, beta a OS=Danio rerio OX=7955 GN=myh7b PE=1 SV=3
8	Q8TDY2	1.2	35.4	1594	0.122	0.070	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
9	F1M853	2.2	34.7	1453	0.084	0.053	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
10	O76014	2.6	34.3	449	0.084	0.171	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
11	Q811D2	2.9	34.3	1581	0.082	0.047	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
12	F1R3G4	3.0	34.3	1992	0.052	0.024	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
13	I3ISA3	3.0	34.3	1986	0.052	0.024	I3ISA3_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
14	A8IQT2	3.3	33.9	576	0.106	0.168	CCD40_CHLRE Coiled-coil domain-containing protein 40 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CCDC40 PE=1 SV=1
15	B8ZZW2	3.5	33.9	916	0.107	0.107	B8ZZW2_HUMAN GRIP and coiled-coil domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=1
16	Q8IWJ2	3.9	33.9	1684	0.108	0.059	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
17	P13533	4.1	33.9	1939	0.071	0.034	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5
18	A0A1D8PN92	4.3	33.9	1948	0.098	0.046	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
19	Q4V3D6	4.4	33.5	463	0.075	0.149	FLOT2_ARATH Flotillin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLOT2 PE=2 SV=1
20	Q02566	4.5	33.5	1938	0.075	0.036	MYH6_MOUSE Myosin-6 OS=Mus musculus OX=10090 GN=Myh6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13851 GAS	6.1	17.7	Growth-arrest specific micro-tubule binding
2	PF12718 Tropomyosin_1	9.2e+02	11.4	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379047	0.796	Mitochondrial potassium channel located in the mitochondrial inner membrane . Together with ABCB8/MITOSUR, forms a protein complex localized in the mitochondria that mediates ATP- dependent potassium currents across the inner membrane (that is, mitoK(ATP) channel) . May contribute to the homeostatic control of cellular metabolism under stress conditions by regulating the mitochondrial matrix volume .
2	9606.ENSP00000292562	0.776	Zinc finger protein 251
3	9606.ENSP00000304592	0.761	Fatty acid synthase
4	9606.ENSP00000221671	0.653	Uncharacterized protein C19orf44
5	9606.ENSP00000357126	0.642	Olfactory receptor 6K6
6	9606.ENSP00000380116	0.619	Proline and serine rich 3
7	9606.ENSP00000345102	0.602	Uncharacterized protein PEAK3
8	9606.ENSP00000350378	0.602	Golgin subfamily A member 7
9	9606.ENSP00000325203	0.594	Olfactory receptor 6T1
10	9606.ENSP00000295124	0.534	Coiled-coil domain containing 138
11	9606.ENSP00000293725	0.517	Zinc finger protein 563
12	9606.ENSP00000238156	0.507	Coiled-coil domain containing 92
13	9606.ENSP00000275732	0.507	GRB10-interacting GYF protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.981	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0022607	0.965	cellular component assembly
GO:0070925	0.964	organelle assembly
GO:0044782	0.887	cilium organization
GO:0048522	0.885	positive regulation of cellular process
GO:0065003	0.858	protein-containing complex assembly
GO:0060271	0.807	cilium assembly
GO:0051258	0.798	protein polymerization
GO:0031109	0.796	microtubule polymerization or depolymerization
GO:0051726	0.723	regulation of cell cycle
GO:0007099	0.676	centriole replication
GO:0046785	0.624	microtubule polymerization
GO:0007020	0.601	microtubule nucleation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.999	centrosome
GO:0099512	0.995	supramolecular fiber
GO:0005814	0.992	centriole
GO:0005819	0.990	spindle
GO:0005874	0.986	microtubule
GO:0005876	0.979	spindle microtubule
GO:0034451	0.978	centriolar satellite
GO:0005737	0.953	cytoplasm
GO:0043227	0.824	membrane-bounded organelle
GO:0005829	0.740	cytosol
GO:0043231	0.636	intracellular membrane-bounded organelle
GO:0016020	0.381	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]