StarFunc result for job id Q2TAC6

User Input

>input (998 residues)
MKDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRS
REKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQE
PGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQ
VAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQE
VRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRD
SKLTRLLKDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGRAKNIKTRVKQNLLNVSYH
IAQYTSIIADLRGEIQRLKRKIDEQTGRGQARGRQDRGDIRHIQAEVQLHSGQGEKAGMG
QLREQLASAFQEQMDVRRRLLELENRAMEVQIDTSRHLLTIAGWKHEKSRRALKWREEQR
KECYAKDDSEKDSDTGDDQPDILEPPEVAAARESIAALVDEQKQLRKQKLALEQRCRELR
ARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQSHALLRDGALRHRHEAVRRL
EQHRSLCDEIIQGQRQIIDDYNLAVPQRLEELYEVYLRELEEGSLEQATIMDQVASRALQ
DSSLPKITPAGTSLTPDSDLESVKTLSSDAQHLQNSALPPLSTESEGHHVFKAGTGAWQA
KSSSVPTPPPIQLGSLVTQEAPAQDSLGSWINSSPDSSENLSEIPLSHKERKEILTGTKC
IWVKAARRRSRALGTEGRHLLAPATERSSLSLHSLSEGDDARPPGPLACKRPPSPTLQHA
ASEDNLSSSTGEAPSRAVGHHGDGPRPWLRGQKKSLGKKREESLEAKRRKRRSRSFEVTG
QGLSHPKTHLLGPHQAERISDHRMPVCRHPAPGIRHLGKVTLPLAKVKLPPSQNTGPGDS
SPLAVPPNPGGGSRRATRGPRLPHGTSTHGKDGCSRHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99PT9	0.368	0.369	0.000	997	0.896	0.897	Q99PT9.pdb.gz	KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2
2	AFDB:E9QC56	0.365	0.399	7.467E-80	911	0.461	0.505	E9QC56.pdb.gz
3	AFDB:G5EAS6	0.346	0.349	9.355E-53	989	0.281	0.283	G5EAS6.pdb.gz	G5EAS6_EMENI Kinesin-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kipB PE=3 SV=1
4	AFDB:Q2VIQ3	0.324	0.263	7.574E-40	1234	0.251	0.203	Q2VIQ3.pdb.gz	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
5	AFDB:P33174	0.323	0.263	9.876E-39	1231	0.248	0.201	P33174.pdb.gz	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
6	AFDB:Q8S905	0.334	0.342	1.043E-38	974	0.203	0.208	Q8S905.pdb.gz	KN7A_ARATH Kinesin-like protein KIN-7A OS=Arabidopsis thaliana OX=3702 GN=KIN7A PE=1 SV=1
7	AFDB:Q9XZ29	0.325	0.269	4.318E-38	1212	0.230	0.190	Q9XZ29.pdb.gz	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
8	AFDB:Q8S950	0.341	0.355	1.288E-37	959	0.199	0.208	Q8S950.pdb.gz	KN7A_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum OX=4097 GN=NACK1 PE=1 SV=1
9	AFDB:Q57ZS8	0.331	0.304	1.692E-37	1088	0.146	0.134	Q57ZS8.pdb.gz	Q57ZS8_TRYB2 OSM3-like kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.90 PE=3 SV=1
10	AFDB:Q54NP8	0.329	0.175	3.015E-34	1922	0.177	0.092	Q54NP8.pdb.gz	KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum OX=44689 GN=kif4 PE=2 SV=1
11	PDB:7wrgA	0.311	0.381	2.468E-31	812	0.140	0.172	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.300	0.380	1.407E-29	783	0.133	0.170	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.279	0.410	1.029E-24	670	0.103	0.154	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:4o9yA	0.051	0.028	3.558E-1	2490	0.063	0.025	4o9yA.pdb.gz
15	PDB:6cesD	0.065	0.071	3.558E-1	901	0.035	0.039	6cesD.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
16	PDB:5j6hA	0.044	0.127	4.676E-1	275	0.015	0.055	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
17	PDB:7k1wF	0.060	0.101	7.240E-1	462	0.032	0.069	7k1wF.pdb.gz
18	PDB:5kynA	0.066	0.081	7.646E-1	730	0.041	0.056	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
19	PDB:5lkiA	0.074	0.055	7.646E-1	1427	0.082	0.057	5lkiA.pdb.gz
20	PDB:6tz402	0.071	0.293	7.646E-1	176	0.017	0.097	6tz402.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99PT9	0.0	1766	997	0.897	0.898	KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2
2	A0A494BYR6	2.23e-103	344	842	0.180	0.214	A0A494BYR6_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF18B PE=1 SV=1
3	Q86Y91	2.33e-103	345	852	0.180	0.211	KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens OX=9606 GN=KIF18B PE=1 SV=4
4	G5EAS6	6.28e-103	347	989	0.177	0.179	G5EAS6_EMENI Kinesin-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kipB PE=3 SV=1
5	A0A0G2JW74	1.29e-102	343	886	0.196	0.221	A0A0G2JW74_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif18a PE=3 SV=2
6	Q91WD7	2.50e-102	343	886	0.196	0.221	KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus OX=10090 GN=Kif18a PE=2 SV=1
7	Q8NI77	2.96e-101	340	898	0.187	0.208	KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens OX=9606 GN=KIF18A PE=1 SV=2
8	O14343	7.41e-99	333	883	0.191	0.216	KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp5 PE=1 SV=1
9	A0A1D8PKA4	1.19e-98	335	972	0.173	0.178	A0A1D8PKA4_CANAL Kinesin-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KIP3 PE=1 SV=1
10	P53086	1.23e-93	317	805	0.167	0.207	KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP3 PE=1 SV=1
11	Q6S002	7.60e-93	323	1238	0.192	0.155	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
12	O59751	1.35e-92	313	784	0.188	0.240	KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp6 PE=1 SV=1
13	M9PF35	4.04e-90	306	740	0.170	0.230	M9PF35_DROME Kinesin-like protein at 67A, isoform B OS=Drosophila melanogaster OX=7227 GN=Klp67A PE=1 SV=1
14	Q9VSW5	7.81e-90	307	814	0.171	0.210	Q9VSW5_DROME Kinesin-like protein at 67A, isoform A OS=Drosophila melanogaster OX=7227 GN=Klp67A PE=1 SV=1
15	P91945	7.89e-90	307	814	0.171	0.210	P91945_DROME Kinesin like protein 67a OS=Drosophila melanogaster OX=7227 GN=Klp67A PE=2 SV=1
16	D3ZIA5	6.22e-86	296	811	0.165	0.203	D3ZIA5_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif18a PE=3 SV=1
17	Q2VIQ3	1.57e-74	270	1234	0.157	0.127	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
18	O95239	4.71e-74	268	1232	0.155	0.126	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
19	P33174	2.89e-73	266	1231	0.151	0.123	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
20	Q9VRK9	4.96e-71	251	677	0.155	0.229	Q9VRK9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=Klp64D PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16374 CIF	77	14.8	Cycle inhibiting factor (CIF)
2	PF08702 Fib_alpha	1.4e+02	14.1	Fibrinogen alpha/beta chain family
3	PF00225 Kinesin	5.8e-107	369.1	Kinesin motor domain
4	PF16796 Microtub_bd	1.2e-18	78.9	Microtubule binding
5	PF12329 TMF_DNA_bd	20	16.6	TATA element modulatory factor 1 DNA binding
6	PF15136 UPF0449	2.5e+02	13.5	Uncharacterised protein family UPF0449

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260731	0.857	Kinesin-like protein KIF11
2	9606.ENSP00000432768	0.787	Cytoskeleton-associated protein 5
3	9606.ENSP00000393963	0.780	Kinesin-like protein KIFC1
4	9606.ENSP00000401514	0.745	Dynein heavy chain 1, axonemal
5	9606.ENSP00000363799	0.742	Actin-like protein 7B
6	9606.ENSP00000233121	0.708	Microtubule-associated protein RP/EB family member 3
7	9606.ENSP00000387875	0.695	Chromosome-associated kinesin KIF4B
8	9606.ENSP00000265148	0.694	Centromere-associated protein E
9	9606.ENSP00000404190	0.691	Rac GTPase-activating protein 1
10	9606.ENSP00000363524	0.687	Chromosome-associated kinesin KIF4A
11	9606.ENSP00000269878	0.673	Calcium and integrin binding family member 3
12	9606.ENSP00000354560	0.673	Kinesin-associated protein 3
13	9606.ENSP00000260363	0.638	Kinesin-like protein KIF23
14	9606.ENSP00000385000	0.637	Kinesin-like protein KIF2A
15	9606.ENSP00000377793	0.634	Protein regulator of cytokinesis 1
16	9606.ENSP00000444628	0.634	Beta-galactosidase-1-like protein 2
17	9606.ENSP00000361298	0.623	Kinesin-like protein KIF2C
18	9606.ENSP00000349961	0.622	Structural maintenance of chromosomes protein 4
19	9606.ENSP00000348965	0.616	Cytoplasmic dynein 1 heavy chain 1
20	9606.ENSP00000296509	0.610	Mitotic spindle assembly checkpoint protein MAD2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008574	0.998	plus-end-directed microtubule motor activity
GO:0005515	0.997	protein binding
GO:0008092	0.847	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.997	cellular component organization
GO:0007017	0.991	microtubule-based process
GO:0007010	0.985	cytoskeleton organization
GO:0000226	0.977	microtubule cytoskeleton organization
GO:0022411	0.881	cellular component disassembly
GO:0031109	0.872	microtubule polymerization or depolymerization
GO:0032984	0.856	protein-containing complex disassembly
GO:0051261	0.854	protein depolymerization
GO:0007019	0.698	microtubule depolymerization
GO:0050789	0.685	regulation of biological process
GO:0050794	0.678	regulation of cellular process
GO:0030030	0.626	cell projection organization
GO:0022607	0.446	cellular component assembly
GO:0007049	0.363	cell cycle
GO:0022402	0.321	cell cycle process
GO:0000278	0.320	mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005622	0.996	intracellular anatomical structure
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0120025	0.980	plasma membrane bounded cell projection
GO:0015630	0.971	microtubule cytoskeleton
GO:0005737	0.964	cytoplasm
GO:0005929	0.948	cilium
GO:0005829	0.934	cytosol
GO:0032991	0.929	protein-containing complex
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0099080	0.636	supramolecular complex
GO:0005634	0.583	nucleus
GO:0005874	0.389	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.3	0.998	plus-end-directed kinesin ATPase.

[back to server]