StarFunc result for job id Q2TAL6

User Input

>input (325 residues)
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVN
ELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQA
EALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TAL6	1.000	1.000	1.703E-55	325	1.000	1.000	Q2TAL6.pdb.gz	VWC2_HUMAN Brorin OS=Homo sapiens OX=9606 GN=VWC2 PE=1 SV=1
2	AFDB:B0I1T8	0.554	0.582	7.274E-33	309	0.505	0.531	B0I1T8.pdb.gz	B0I1T8_DANRE Brorin OS=Danio rerio OX=7955 GN=brorin PE=2 SV=1
3	AFDB:B0UZC8	0.486	0.684	8.032E-28	223	0.375	0.547	B0UZC8.pdb.gz	VWC2L_DANRE von Willebrand factor C domain-containing protein 2-like OS=Danio rerio OX=7955 GN=vwc2l PE=2 SV=1
4	AFDB:B2RUY7	0.485	0.687	2.580E-27	222	0.345	0.505	B2RUY7.pdb.gz	VWC2L_HUMAN von Willebrand factor C domain-containing protein 2-like OS=Homo sapiens OX=9606 GN=VWC2L PE=1 SV=1
5	PDB:3ix0B	0.143	0.395	7.660E-1	94	0.034	0.117	3ix0B.pdb.gz
6	PDB:8a7eC	0.077	0.023	1.543	1524	0.089	0.019	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
7	PDB:7lpsA	0.060	0.032	1.734	781	0.046	0.019	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
8	PDB:2oy5O	0.085	0.106	1.948	250	0.040	0.052	2oy5O.pdb.gz
9	PDB:1a7aA	0.075	0.057	2.321	431	0.012	0.009	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
10	PDB:7pi3A	0.071	0.071	2.608	328	0.049	0.049	7pi3A.pdb.gz	Heterotypic interactions drive antibody synergy against a malaria vaccine candidate.
11	PDB:3h9uC	0.075	0.056	2.765	435	0.018	0.014	3h9uC.pdb.gz	Crystal structure of S-adenosyl homocysteine hydrolase (SAHH) from Trypanosoma brucei
12	PDB:7q3dA	0.084	0.055	2.765	545	0.049	0.029	7q3dA.pdb.gz
13	PDB:7wtbB	0.086	0.037	2.931	1147	0.049	0.014	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
14	PDB:6jkaC	0.065	0.089	3.108	228	0.025	0.035	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
15	AFDB:P31367	0.072	0.043	6.040	610	0.138	0.074	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TAL6	0.0	659	325	1.000	1.000	VWC2_HUMAN Brorin OS=Homo sapiens OX=9606 GN=VWC2 PE=1 SV=1
2	Q8C8N3	0.0	597	324	0.908	0.910	VWC2_MOUSE Brorin OS=Mus musculus OX=10090 GN=Vwc2 PE=1 SV=1
3	B0I1T8	3.21e-113	332	309	0.498	0.524	B0I1T8_DANRE Brorin OS=Danio rerio OX=7955 GN=brorin PE=2 SV=1
4	B0UZC8	1.19e-79	243	223	0.372	0.543	VWC2L_DANRE von Willebrand factor C domain-containing protein 2-like OS=Danio rerio OX=7955 GN=vwc2l PE=2 SV=1
5	B2RUY7	3.78e-75	232	222	0.332	0.486	VWC2L_HUMAN von Willebrand factor C domain-containing protein 2-like OS=Homo sapiens OX=9606 GN=VWC2L PE=1 SV=1
6	Q505H4	1.05e-74	231	222	0.326	0.477	VWC2L_MOUSE von Willebrand factor C domain-containing protein 2-like OS=Mus musculus OX=10090 GN=Vwc2l PE=1 SV=1
7	Q76LD0	1.26e-09	61.2	447	0.145	0.105	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
8	Q920C1	1.29e-09	61.2	447	0.145	0.105	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1
9	Q7T3Q2	1.74e-09	61.2	1027	0.142	0.045	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
10	Q9BU40	2.61e-09	60.5	456	0.142	0.101	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
11	Q9NZV1	1.89e-08	58.2	1036	0.135	0.042	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
12	Q96DN2	2.14e-08	57.8	955	0.148	0.050	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
13	F1Q633	1.18e-06	52.8	3970	0.129	0.011	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
14	A0A0R4IQJ3	1.21e-06	52.8	4003	0.129	0.010	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
15	B4XEZ3	1.32e-06	52.0	454	0.114	0.081	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
16	Q8VEA6	2.02e-05	48.1	426	0.086	0.066	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
17	Q3U492	2.28e-05	48.5	1550	0.129	0.027	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
18	G5EF34	7.56e-05	47.0	966	0.129	0.043	G5EF34_CAEEL Cysteine-rich motor neuron 1 protein-like OS=Caenorhabditis elegans OX=6239 GN=crm-1 PE=1 SV=1
19	Q80T14	1.53e-04	46.2	4010	0.151	0.012	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
20	Q6WN34	6.73e-04	43.5	429	0.123	0.093	CRDL2_HUMAN Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05375 Pacifastin_I	0.97	20.5	Pacifastin inhibitor (LCMII)
2	PF00093 VWC	1.3e-07	43.2	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341819

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296526	0.779	Glutamate receptor 2
2	9606.ENSP00000204604	0.725	Chordin
3	9606.ENSP00000410811	0.723	Fidgetin-like protein 1
4	9606.ENSP00000455068	0.669	Meteorin
5	9606.ENSP00000390661	0.656	C-type lectin domain family 2 member L
6	9606.ENSP00000046087	0.647	Zona pellucida-binding protein 1
7	9606.ENSP00000005284	0.630	Voltage-dependent calcium channel gamma-3 subunit
8	9606.ENSP00000365503	0.629	Protein shisa-7
9	9606.ENSP00000385957	0.629	Kelch repeat and BTB domain containing 12
10	9606.ENSP00000428994	0.623	Glutamate receptor 1
11	9606.ENSP00000275162	0.619	Clavesin-2
12	9606.ENSP00000308976	0.602	Von Willebrand factor C domain-containing protein 2-like
13	9606.ENSP00000360608	0.598	Glutamate receptor ionotropic, NMDA 1
14	9606.ENSP00000282499	0.596	Glutamate receptor 4
15	9606.ENSP00000453940	0.592	Coiled-coil domain containing 175
16	9606.ENSP00000327468	0.590	Kelch domain-containing protein 8B
17	9606.ENSP00000390084	0.590	Protein shisa-6 homolog
18	9606.ENSP00000282020	0.585	Glutamate receptor ionotropic, delta-2
19	9606.ENSP00000310003	0.585	Protein cornichon homolog 2
20	9606.ENSP00000454014	0.583	Protein shisa-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0090092	0.973	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.957	regulation of cellular response to growth factor stimulus
GO:0090288	0.900	negative regulation of cellular response to growth factor stimulus
GO:0090101	0.849	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030510	0.687	regulation of BMP signaling pathway
GO:0048522	0.632	positive regulation of cellular process
GO:0009987	0.580	cellular process
GO:0045595	0.428	regulation of cell differentiation
GO:0030514	0.423	negative regulation of BMP signaling pathway
GO:0051094	0.374	positive regulation of developmental process
GO:0045664	0.351	regulation of neuron differentiation
GO:0045597	0.346	positive regulation of cell differentiation
GO:0045666	0.343	positive regulation of neuron differentiation
GO:0032501	0.304	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.997	extracellular region
GO:0098797	0.993	plasma membrane protein complex
GO:0034702	0.990	ion channel complex
GO:0043235	0.985	receptor complex
GO:0098802	0.980	plasma membrane signaling receptor complex
GO:0005615	0.978	extracellular space
GO:0098878	0.956	neurotransmitter receptor complex
GO:0008328	0.954	ionotropic glutamate receptor complex
GO:0032281	0.800	AMPA glutamate receptor complex
GO:0043226	0.762	organelle
GO:0005622	0.732	intracellular anatomical structure
GO:0043231	0.690	intracellular membrane-bounded organelle
GO:0005737	0.615	cytoplasm
GO:0030312	0.424	external encapsulating structure
GO:0031012	0.406	extracellular matrix
GO:0005604	0.349	basement membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]