StarFunc result for job id Q2TAL8

User Input

>input (776 residues)
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLS
PQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQI
QAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTAS
VLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT
ITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKEK
MVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQQ
QPQQQTPQEQTPPPQQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEEGLE
VWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARNGEG
EPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGYVLP
SHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKNPSN
PKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLFKCPQSVKGR
NDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQEAIAVANASTMH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UA37	0.612	0.611	4.360E-93	777	0.991	0.990	Q3UA37.pdb.gz	QRIC1_MOUSE Transcriptional regulator QRICH1 OS=Mus musculus OX=10090 GN=Qrich1 PE=1 SV=1
2	AFDB:Q57W20	0.059	0.040	8.713E-2	1370	0.155	0.088	Q57W20.pdb.gz	Q57W20_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28I8.20 PE=4 SV=1
3	AFDB:F4IKX0	0.072	0.060	9.150E-2	1108	0.090	0.063	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
4	AFDB:F4JAU2	0.106	0.061	2.686E-1	1697	0.128	0.058	F4JAU2.pdb.gz	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
5	PDB:6gypE	0.111	0.157	3.146E-1	512	0.073	0.111	6gypE.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
6	AFDB:A0A5K7RLP0	0.066	0.081	6.482E-1	589	0.102	0.134	A0A5K7RLP0.pdb.gz	MEIOS_MOUSE Meiosis initiator protein OS=Mus musculus OX=10090 GN=Meiosin PE=1 SV=1
7	PDB:3lomA	0.052	0.110	1.123	288	0.032	0.087	3lomA.pdb.gz
8	AFDB:A1Z968	0.067	0.044	1.351	1488	0.104	0.054	A1Z968.pdb.gz	A1Z968_DROME NAT1, isoform D OS=Drosophila melanogaster OX=7227 GN=NAT1 PE=1 SV=1
9	PDB:4yzfA	0.051	0.073	1.507	475	0.030	0.048	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
10	PDB:1p4eB	0.104	0.169	1.582	413	0.037	0.070	1p4eB.pdb.gz	The role of the conserved Trp330 in Flp-mediated recombination. Functional and structural analysis
11	PDB:6rrdO	0.078	0.109	1.661	504	0.031	0.048	6rrdO.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
12	AFDB:B9EKI5	0.042	0.039	1.812	938	0.107	0.088	B9EKI5.pdb.gz	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
13	PDB:4abnB	0.069	0.104	1.832	426	0.035	0.063	4abnB.pdb.gz
14	PDB:3r2qA	0.067	0.184	1.924	202	0.032	0.124	3r2qA.pdb.gz	Structural and Functional Genomics of YibF, a Glutathione Transferase Homologue from Escherichia coli
15	PDB:2o36A	0.066	0.075	2.122	654	0.036	0.043	2o36A.pdb.gz	Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase.
16	PDB:6nd4Q	0.087	0.080	2.229	862	0.035	0.031	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
17	PDB:4ezcB	0.077	0.139	2.340	346	0.026	0.058	4ezcB.pdb.gz	Structure and permeation mechanism of a mammalian urea transporter.
18	AFDB:O88573	0.080	0.057	2.552	1216	0.130	0.083	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
19	AFDB:Q9P2D8	0.065	0.033	2.680	2635	0.120	0.035	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
20	AFDB:A0A0R4IWL6	0.065	0.052	3.104	1152	0.138	0.093	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3Z9	0.0	1577	776	1.000	1.000	A1L3Z9_HUMAN Glutamine-rich 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=2 SV=1
2	Q2TAL8	0.0	1577	776	1.000	1.000	QRIC1_HUMAN Transcriptional regulator QRICH1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=1
3	Q3UA37	0.0	1563	777	0.992	0.991	QRIC1_MOUSE Transcriptional regulator QRICH1 OS=Mus musculus OX=10090 GN=Qrich1 PE=1 SV=1
4	A0A0B4K7W6	2.40e-81	276	712	0.175	0.191	A0A0B4K7W6_DROME Without children, isoform C OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
5	Q95TK6	1.63e-78	275	1043	0.175	0.130	Q95TK6_DROME LD44304p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
6	A8JRE3	9.10e-78	276	1703	0.175	0.080	A8JRE3_DROME Without children, isoform B OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
7	Q6AWL3	9.38e-78	276	1688	0.175	0.081	Q6AWL3_DROME RE05635p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
8	Q9VB55	9.74e-78	276	1688	0.175	0.081	Q9VB55_DROME Without children, isoform A OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=2
9	A0A0B4KHZ0	9.81e-78	276	1702	0.175	0.080	A0A0B4KHZ0_DROME Without children, isoform E OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
10	A0A0B4KI43	1.05e-77	276	1687	0.175	0.081	A0A0B4KI43_DROME Without children, isoform D OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
11	Q9N9Z6	1.12e-77	276	1688	0.175	0.081	Q9N9Z6_DROME WOC protein OS=Drosophila melanogaster OX=7227 GN=woc PE=4 SV=1
12	Q9JLM4	3.03e-76	271	1370	0.179	0.101	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1
13	Q5VZL5	1.10e-75	270	1548	0.186	0.093	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
14	A6NHB5	9.35e-75	267	1372	0.180	0.102	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
15	Q14202	9.39e-75	267	1370	0.180	0.102	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
16	C9JIA8	6.42e-64	210	103	0.133	1.000	C9JIA8_HUMAN Glutamine rich 1 (Fragment) OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=8
17	Q9UBW7	2.39e-63	233	1377	0.166	0.094	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
18	Q9CU65	1.20e-62	231	1376	0.155	0.087	ZMYM2_MOUSE Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3
19	A6NHN7	2.29e-21	102	1280	0.057	0.034	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
20	Q8N8K9	1.90e-04	47.4	716	0.054	0.059	K1958_HUMAN Uncharacterized protein KIAA1958 OS=Homo sapiens OX=9606 GN=KIAA1958 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	8.6	17.8	Caspase recruitment domain
2	PF12012 DUF3504	1.2e-58	209.2	Domain of unknown function (DUF3504)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378830

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317743	0.817	Putative nuclease HARBI1
2	9606.ENSP00000339179	0.785	Testis-specific serine/threonine-protein kinase 4
3	9606.ENSP00000431404	0.776	PiggyBac transposable element-derived protein 5
4	9606.ENSP00000463080	0.763	Probable E3 ubiquitin-protein ligase MARCH10
5	9606.ENSP00000483621	0.746	Calcium-binding tyrosine phosphorylation-regulated protein
6	9606.ENSP00000360913	0.740	Spermatogenesis-associated protein 6
7	9606.ENSP00000352463	0.711	Transcription factor 20
8	9606.ENSP00000295201	0.672	Tektin-4
9	9606.ENSP00000262765	0.666	Glutamine-rich protein 2
10	9606.ENSP00000320949	0.658	CCR4-NOT transcription complex subunit 1
11	9606.ENSP00000261883	0.652	Cartilage intermediate layer protein 1
12	9606.ENSP00000452280	0.603	Prostaglandin reductase 2
13	9606.ENSP00000351926	0.597	AP-2 complex subunit alpha-1
14	9606.ENSP00000387170	0.574	GRB10-interacting GYF protein 2
15	9606.ENSP00000374280	0.569	RNA polymerase-associated protein RTF1 homolog
16	9606.ENSP00000428585	0.557	Small integral membrane protein 12
17	9606.ENSP00000440504	0.557	Uncharacterized protein KIAA1958
18	9606.ENSP00000358316	0.554	Pleckstrin homology domain containing S1
19	9606.ENSP00000373948	0.551	Cilia- and flagella-associated protein 69
20	9606.ENSP00000349568	0.548	Cilia and flagella associated protein 43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.995	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0050896	0.967	response to stimulus
GO:0009889	0.956	regulation of biosynthetic process
GO:0051252	0.956	regulation of RNA metabolic process
GO:0010556	0.954	regulation of macromolecule biosynthetic process
GO:0010468	0.953	regulation of gene expression
GO:0031326	0.952	regulation of cellular biosynthetic process
GO:0048518	0.896	positive regulation of biological process
GO:0048522	0.890	positive regulation of cellular process
GO:0006355	0.889	regulation of DNA-templated transcription
GO:0010604	0.877	positive regulation of macromolecule metabolic process
GO:0051173	0.875	positive regulation of nitrogen compound metabolic process
GO:0051716	0.864	cellular response to stimulus
GO:0034976	0.808	response to endoplasmic reticulum stress
GO:0031325	0.797	positive regulation of cellular metabolic process
GO:0071310	0.793	cellular response to organic substance
GO:0045935	0.777	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.769	positive regulation of RNA metabolic process
GO:0035966	0.692	response to topologically incorrect protein
GO:0006984	0.691	ER-nucleus signaling pathway
GO:0008219	0.637	cell death
GO:0035556	0.602	intracellular signal transduction
GO:0010557	0.601	positive regulation of macromolecule biosynthetic process
GO:0031328	0.600	positive regulation of cellular biosynthetic process
GO:0006986	0.596	response to unfolded protein
GO:0035967	0.587	cellular response to topologically incorrect protein
GO:0045893	0.585	positive regulation of DNA-templated transcription
GO:0097193	0.545	intrinsic apoptotic signaling pathway
GO:0032502	0.522	developmental process
GO:0034620	0.501	cellular response to unfolded protein
GO:0032501	0.476	multicellular organismal process
GO:0070059	0.464	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0030968	0.464	endoplasmic reticulum unfolded protein response
GO:0048856	0.463	anatomical structure development
GO:0010941	0.456	regulation of cell death
GO:0008152	0.430	metabolic process
GO:0007275	0.375	multicellular organism development
GO:0071704	0.360	organic substance metabolic process
GO:0042981	0.323	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]