StarFunc result for job id Q2TAZ0

User Input

>input (1938 residues)
MSRWLWPWSNCVKERVCRYLLHHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLEIWSVN
EVLESMESPLELVEGFVGSIEVAVPWAALLTDHCTVRVSGLQLTLQPRRGPAPGAADSQS
WASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLDTVVRVEH
SPGDGERGVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELP
AQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQEL
LSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLD
NTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDT
MRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQ
RACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEIL
TFPGTLGSQASARPCAHLRHTQILRRVPKSRPRRSVACHCHSELALDLANFQADVELGAL
DRLAALLRLATVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPWA
GQAVRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKPPVPCLRVSK
ALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSK
RTMYETEEMVIPGDPEEMRTFQSRTLALSRCSLEVILPSVHIFLPSKEVYESIYNRINND
LLMWEPADLLPTPDPAAQPSGFPGPSGFWHDSFKMCKSAFKLANCFDLTPDSDSDDEDAH
FFSVGASGGPQAAAPEAPSLHLQSTFSTLVTVLKGRITALCETKDEGGKRLEAVHGELVL
DMEHGTLFSVSQYCGQPGLGYFCLEAEKATLYHRAAVDDYPLPSHLDLPSFAPPAQLAPT
IYPSEEGVTERGASGRKGQGRGPHMLSTAVRIHLDPHKNVKEFLVTLRLHKATLRHYMAL
PEQSWHSQLLEFLDVLDDPVLGYLPPTVITILHTHLFSCSVDYRPLYLPVRVLITAETFT
LSSNIIMDTSTFLLRFILDDSALYLSDKCEVETLDLRRDYVCVLDVDLLELVIKTWKGST
EGKLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYVMSTGDLHPPPRPPSPTEIAGQKL
SESPASLPSCPPVETALINQRDLADALLDTERSLRELAQPSGGHLPQASPISVYLFPGER
SGAPPPSPPVGGPAGSLGSCSEEKEDEREEEGDGDTLDSDEFCILDAPGLGIPPRDGEPV
VTQLHPGPIVVRDGYFSRPIGSTDLLRAPAHFPVPSTRVVLREVSLVWHLYGGRDFGPHP
GHRARTGLSGPRSSPSRCSGPNRPQNSWRTQGGSGRQHHVLMEIQLSKVSFQHEVYPAEP
ATGPAAPSQELEERPLSRQVFIVQELEVRDRLASSQINKFLYLHTSERMPRRAHSNMLTI
KALHVAPTTNLGGPECCLRVSLMPLRLNVDQDALFFLKDFFTSLVAGINPVVPGETSAEA
RPETRAQPSSPLEGQAEGVETTGSQEAPGGGHSPSPPDQQPIYFREFRFTSEVPIWLDYH
GKHVTMDQVGTFAGLLIGLAQLNCSELKLKRLCCRHGLLGVDKVLGYALNEWLQDIRKNQ
LPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLMRGLQRGAASFGSSTASAALEL
SNRLVQAIQATAETVYDILSPAAPVSRSLQDKRSARRLRRGQQPADLREGVAKAYDTVRE
GILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPLILATEATSSLLGGMRNQIV
PDAHKDHALKWRSDSAQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TAZ0	1.000	1.000	0.000	1938	1.000	1.000	Q2TAZ0.pdb.gz	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
2	AFDB:Q96BY7	0.748	0.700	0.000	2078	0.450	0.420	Q96BY7.pdb.gz	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
3	AFDB:Q9VZX7	0.669	0.679	0.000	1906	0.282	0.287	Q9VZX7.pdb.gz	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
4	PDB:6a9eA	0.076	0.371	2.776E-7	339	0.015	0.086	6a9eA.pdb.gz
5	AFDB:Q86UR5	0.033	0.036	1.959E-3	1692	0.092	0.105	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
6	AFDB:Q9EQZ7	0.029	0.036	5.119E-3	1530	0.097	0.123	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
7	AFDB:O95153	0.027	0.027	1.039E-2	1857	0.102	0.107	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
8	AFDB:Q52KB6	0.041	0.038	2.453E-2	2323	0.113	0.094	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
9	AFDB:Q53682	0.036	0.056	5.508E-2	940	0.056	0.115	Q53682.pdb.gz	Q53682_STAAU Fibronectin-binding protein OS=Staphylococcus aureus OX=1280 GN=fnbB PE=1 SV=1
10	AFDB:P97798	0.033	0.037	6.094E-2	1493	0.074	0.096	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
11	PDB:2xe4A	0.034	0.066	6.985E-2	721	0.014	0.037	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
12	PDB:6qk7B	0.035	0.066	6.985E-2	749	0.030	0.077	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:7n9qA	0.027	0.024	9.461E-2	2315	0.011	0.009	7n9qA.pdb.gz
14	PDB:7ajtUA	0.027	0.044	1.047E-1	834	0.015	0.035	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	AFDB:Q9VQW7	0.028	0.034	1.675E-1	1332	0.061	0.089	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
16	PDB:5cskB	0.055	0.054	1.920E-1	2017	0.027	0.026	5cskB.pdb.gz
17	PDB:6oq5A	0.030	0.027	2.472E-1	2346	0.008	0.006	6oq5A.pdb.gz	Structure of the full-length Clostridium difficile toxin B.
18	PDB:1po0A	0.038	0.072	2.877E-1	661	0.022	0.064	1po0A.pdb.gz	Structural evidence for iron-free citrate and ferric citrate binding to the TonB-dependent outer membrane transporter FecA
19	PDB:7ax1A	0.026	0.080	3.522E-1	518	0.005	0.017	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
20	PDB:5cslB	0.030	0.029	3.704E-1	2072	0.017	0.016	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TAZ0	0.0	3936	1938	1.000	1.000	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
2	Q80XK6	0.0	1459	2075	0.462	0.431	ATG2B_MOUSE Autophagy-related protein 2 homolog B OS=Mus musculus OX=10090 GN=Atg2b PE=1 SV=3
3	Q96BY7	0.0	1485	2078	0.461	0.430	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
4	Q9VZX7	6.89e-163	550	1906	0.228	0.232	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
5	Q2XXT6	1.56e-162	548	1873	0.228	0.235	Q2XXT6_DROME CG1241 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=3 SV=1
6	Q95TX2	6.20e-128	425	819	0.153	0.363	Q95TX2_DROME GH26553p OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
7	Q21480	2.45e-42	174	2290	0.047	0.040	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
8	F8S296	1.43e-27	125	1892	0.072	0.073	ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ATG2 PE=2 SV=1
9	O94649	1.36e-21	105	1646	0.059	0.070	ATG2_SCHPO Autophagy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg2 PE=1 SV=4
10	P53855	2.08e-13	78.6	1592	0.045	0.055	ATG2_YEAST Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG2 PE=1 SV=1
11	F4HWS2	2.31e-07	58.9	4146	0.023	0.011	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
12	Q54KX3	1.93e-05	52.8	4246	0.014	0.007	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
13	Q5THJ4	8.74e-05	50.4	4388	0.015	0.007	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
14	P87319	1.27e-04	49.7	3011	0.018	0.012	VP13A_SCHPO Intermembrane lipid transfer protein vps1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps1301 PE=3 SV=2
15	F4JNE2	7.05e-04	47.4	4219	0.012	0.005	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
16	Q96RL7	8.35e-04	47.0	3174	0.020	0.012	VP13A_HUMAN Intermembrane lipid transfer protein VPS13A OS=Homo sapiens OX=9606 GN=VPS13A PE=1 SV=2
17	Q5H8C4	0.001	46.2	3166	0.035	0.021	VP13A_MOUSE Intermembrane lipid transfer protein VPS13A OS=Mus musculus OX=10090 GN=Vps13a PE=1 SV=1
18	Q07878	0.21	39.3	3144	0.010	0.006	VPS13_YEAST Intermembrane lipid transfer protein VPS13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS13 PE=1 SV=1
19	Q9DBB8	1.6	35.8	333	0.010	0.060	DHDH_MOUSE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1
20	Q9VMN5	1.9	35.8	576	0.012	0.040	CH60C_DROME 60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hsp60C PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13329 ATG2_CAD	7.1	17.9	Autophagy-related protein 2 CAD motif
2	PF09333 ATG_C	1.1e-23	94.7	Autophagy-related protein C terminal domain
3	PF12624 Chorein_N	1.3e-15	68.8	N-terminal region of Chorein or VPS13

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348848	0.996	WD repeat domain phosphoinositide-interacting protein 4
2	9606.ENSP00000262139	0.994	WD repeat domain phosphoinositide-interacting protein 1
3	9606.ENSP00000288828	0.987	WD repeat domain phosphoinositide-interacting protein 2
4	9606.ENSP00000324560	0.945	Serine/threonine-protein kinase ULK1
5	9606.ENSP00000378914	0.943	Serine/threonine-protein kinase ULK2
6	9606.ENSP00000386710	0.924	Autophagy-related protein 9A
7	9606.ENSP00000361306	0.872	Cysteine protease ATG4A
8	9606.ENSP00000353010	0.860	Autophagy-related protein 2 homolog B
9	9606.ENSP00000262039	0.784	Phosphatidylinositol 3-kinase catalytic subunit type 3
10	9606.ENSP00000355231	0.784	Beclin-1
11	9606.ENSP00000376139	0.784	Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation . Binds phosphatidylinositol 3-phosphate (PtdIns3P) forming on membranes of the endoplasmic reticulum upon activation of the upstream ULK1 and PI3 kinases and is recruited at phagophore assembly sites where it regulates the elongation of nascent phagophores downstream of WIPI2 . In the cellular response to starvation, may also function together with the TSC1-TSC2 complex and RB1CC1 in th [...]
12	9606.ENSP00000283290	0.774	Ubiquitin-like-conjugating enzyme ATG3
13	9606.ENSP00000346437	0.772	Ubiquitin-like modifier-activating enzyme ATG7
14	9606.ENSP00000358072	0.772	Autophagy protein 5
15	9606.ENSP00000349205	0.771	Phosphoinositide 3-kinase regulatory subunit 4
16	9606.ENSP00000425107	0.767	Ubiquitin-like protein ATG12
17	9606.ENSP00000432412	0.766	Autophagy-related protein 13
18	9606.ENSP00000311318	0.764	Cysteine protease ATG4D
19	9606.ENSP00000375872	0.761	Autophagy-related protein 16-1
20	9606.ENSP00000338990	0.756	Autophagy-related protein 101

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0120013	1.000	lipid transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0044237	0.995	cellular metabolic process
GO:0000045	0.990	autophagosome assembly
GO:0019222	0.986	regulation of metabolic process
GO:0016241	0.983	regulation of macroautophagy
GO:0044088	0.976	regulation of vacuole organization
GO:1902117	0.976	positive regulation of organelle assembly
GO:0010508	0.976	positive regulation of autophagy
GO:0016239	0.972	positive regulation of macroautophagy
GO:2000785	0.933	regulation of autophagosome assembly
GO:0044090	0.371	positive regulation of vacuole organization
GO:0071704	0.354	organic substance metabolic process
GO:0051179	0.305	localization
GO:0044238	0.305	primary metabolic process
GO:0043170	0.301	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044232	0.997	organelle membrane contact site
GO:0043227	0.972	membrane-bounded organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005737	0.938	cytoplasm
GO:0012505	0.781	endomembrane system
GO:0016020	0.769	membrane
GO:0005829	0.751	cytosol
GO:0031982	0.632	vesicle
GO:0005768	0.361	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]