StarFunc result for job id Q2TB10

User Input

>input (664 residues)
MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSKSGIQQIIECFRSGTKQLKHI
LLKDVDTIFECKLCRSLFRGLPNLITHKKFYCPPSLQMDDNLPDVNDKQSQAINDLLEAI
YPSVDKREYIIKLEPIETNQNAVFQYISRTDNPIEVTESSSTPEQTEVQIQETSTEQSKT
VPVTDTEVETVEPPPVEIVTDEVAPTSDEQPQESQADLETSDNSDFGHQLICCLCRKEFN
SRRGVRRHIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNVLVPLSRSCPVCCKSFATKA
NVRRHFDEVHRGLRRDSITPDIATKPGQPLFLDSISPKKSFKTRKQKSSSKAEYNLTACK
CLLCKRKYSSQIMLKRHMQIVHKITLSGTNSKREKGPNNTANSSEIKVKVEPADSVESSP
PSITHSPQNELKGTNHSNEKKNTPAAQKNKVKQDSESPKSTSPSAAGGQQKTRKPKLSAG
FDFKQLYCKLCKRQFTSKQNLTKHIELHTDGNNIYVKFYKCPLCTYETRRKRDVIRHITV
VHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDGTSNSPSKKY
EVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTKGRSTRS
KALV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QQA8	0.098	0.065	1.251E-3	1095	0.163	0.099	F1QQA8.pdb.gz	ZN219_DANRE Zinc finger protein 219 OS=Danio rerio OX=7955 GN=znf219 PE=1 SV=2
2	AFDB:Q9Y462	0.057	0.051	3.715E-3	761	0.133	0.116	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
3	AFDB:Q90ZW5	0.054	0.035	6.027E-3	1261	0.151	0.079	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
4	AFDB:Q4WPF5	0.097	0.102	1.172E-2	618	0.139	0.149	Q4WPF5.pdb.gz	SEBA_ASPFU C2H2 finger domain transcription factor sebA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sebA PE=4 SV=1
5	AFDB:Q5BIH1	0.078	0.067	2.732E-2	803	0.117	0.097	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:Q9VI93	0.100	0.078	3.926E-2	946	0.140	0.098	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
7	AFDB:E9PEP7	0.071	0.064	5.995E-2	755	0.119	0.105	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
8	AFDB:F4J311	0.077	0.079	7.187E-2	650	0.148	0.151	F4J311.pdb.gz	F4J311_ARATH Zinc finger (C2H2 type) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g29340 PE=4 SV=1
9	AFDB:A0A024R885	0.057	0.045	1.238E-1	898	0.137	0.101	A0A024R885.pdb.gz
10	PDB:3w5kB	0.045	0.213	1.489E-1	110	0.024	0.145	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
11	AFDB:Q4WXZ7	0.065	0.057	1.577E-1	772	0.158	0.136	Q4WXZ7.pdb.gz	Q4WXZ7_ASPFU C2H2 transcription factor (Swi5), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G11250 PE=4 SV=1
12	PDB:1dw9A	0.039	0.133	1.886	156	0.011	0.045	1dw9A.pdb.gz
13	PDB:7w59R	0.046	0.080	2.879	280	0.044	0.104	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:6hlqI	0.035	0.157	3.059	111	0.027	0.162	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
15	PDB:4btsA9	0.037	0.164	3.249	93	0.023	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
16	PDB:6rkwD	0.053	0.047	3.452	781	0.023	0.019	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
17	PDB:5dqrC	0.033	0.051	3.667	421	0.009	0.014	5dqrC.pdb.gz	Crystal Structure and Catalytic Mechanism of 7-Hydroxymethyl Chlorophyll a Reductase
18	PDB:6t9lN	0.046	0.317	3.667	82	0.015	0.122	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
19	PDB:7y9tA	0.037	0.063	4.670	380	0.009	0.016	7y9tA.pdb.gz
20	PDB:3gn5A	0.036	0.152	4.961	132	0.011	0.053	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VEE6	0.0	1281	662	0.944	0.947	ZN800_MOUSE Zinc finger protein 800 OS=Mus musculus OX=10090 GN=Znf800 PE=1 SV=1
2	E9PZZ1	7.79e-07	54.7	754	0.039	0.034	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
3	F1R7D7	3.44e-06	52.8	614	0.057	0.062	F1R7D7_DANRE PR domain zinc finger protein 13 OS=Danio rerio OX=7955 GN=prdm13 PE=4 SV=2
4	B1AWL2	3.99e-06	52.8	2495	0.131	0.035	ZN462_MOUSE Zinc finger protein 462 OS=Mus musculus OX=10090 GN=Znf462 PE=1 SV=1
5	Q96JM2	1.49e-05	50.8	2506	0.131	0.035	ZN462_HUMAN Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3
6	Q90W82	2.62e-05	49.7	563	0.059	0.069	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
7	A0A0B4KFE1	3.22e-05	49.7	1635	0.056	0.023	A0A0B4KFE1_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10543 PE=1 SV=1
8	Q9W2N8	3.28e-05	49.7	1634	0.056	0.023	Q9W2N8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10543 PE=1 SV=3
9	Q86BG2	3.51e-05	49.7	1631	0.056	0.023	Q86BG2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10543 PE=1 SV=2
10	Q92766	3.87e-05	49.7	1687	0.111	0.044	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
11	Q9H2S9	6.66e-05	48.5	585	0.038	0.043	IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=2
12	Q8C208	7.32e-05	48.5	586	0.038	0.043	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
13	F8VPL6	7.55e-05	48.1	540	0.038	0.046	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1
14	Q8MSN5	8.37e-05	48.5	893	0.056	0.041	Q8MSN5_DROME AT15637p OS=Drosophila melanogaster OX=7227 GN=CG10543 PE=2 SV=1
15	Q96C28	1.58e-04	47.0	371	0.060	0.108	ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens OX=9606 GN=ZNF707 PE=1 SV=2
16	Q9NSD4	2.20e-04	46.6	429	0.078	0.121	ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens OX=9606 GN=ZNF275 PE=1 SV=2
17	Q5VV52	2.78e-04	45.8	315	0.062	0.130	ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens OX=9606 GN=ZNF691 PE=1 SV=2
18	Q96EG3	2.92e-04	46.2	531	0.062	0.077	ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens OX=9606 GN=ZNF837 PE=1 SV=2
19	Q6NS86	3.35e-04	46.2	746	0.041	0.036	ZN366_MOUSE Zinc finger protein 366 OS=Mus musculus OX=10090 GN=Znf366 PE=2 SV=1
20	O75123	4.07e-04	45.8	536	0.060	0.075	ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens OX=9606 GN=ZNF623 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15793 FAM35_C	2.4e+02	12.5	Protein family FAM35, C-terminal
2	PF10367 Vps39_2	69	15.3	Vacuolar sorting protein 39 domain 2
3	PF00096 zf-C2H2	1.1e-11	55.6	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	1e-10	52.4	zinc-finger C2H2-type
5	PF18658 zf-C2H2_12	30	15.7	Spin-doc zinc-finger
6	PF12756 zf-C2H2_2	0.045	25.4	C2H2 type zinc-finger (2 copies)
7	PF13894 zf-C2H2_4	6.5e-13	59.3	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	1.2e+02	14.1	C2H2-type zinc finger
9	PF15909 zf-C2H2_8	88	14.9	C2H2-type zinc ribbon
10	PF16293 zf-C2H2_9	9.4	17.5	C2H2 type zinc-finger (1 copy)
11	PF16624 zf-C2H2_assoc2	2.4e-40	148.8	Unstructured region upstream of a zinc-finger
12	PF12171 zf-C2H2_jaz	0.9	21.1	Zinc-finger double-stranded RNA-binding
13	PF05605 zf-Di19	0.15	23.7	Drought induced 19 protein (Di19), zinc-binding
14	PF13465 zf-H2C2_2	43	16.0	Zinc-finger double domain
15	PF13909 zf-H2C2_5	0.58	21.3	C2H2-type zinc-finger domain
16	PF12874 zf-met	0.16	23.6	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376989

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359219	0.631	Kazal-type serine protease inhibitor domain-containing protein 1
2	9606.ENSP00000318821	0.531	GRIP and coiled-coil domain-containing protein 1
3	9606.ENSP00000326240	0.524	Myoneurin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0003677	0.994	DNA binding
GO:0043565	0.782	sequence-specific DNA binding
GO:1990837	0.575	sequence-specific double-stranded DNA binding
GO:0003700	0.352	DNA-binding transcription factor activity
GO:0000981	0.324	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0031018	0.910	endocrine pancreas development
GO:0002067	0.905	glandular epithelial cell differentiation
GO:0050789	0.745	regulation of biological process
GO:0019222	0.530	regulation of metabolic process
GO:0050794	0.516	regulation of cellular process
GO:0060255	0.428	regulation of macromolecule metabolic process
GO:0051171	0.402	regulation of nitrogen compound metabolic process
GO:0080090	0.382	regulation of primary metabolic process
GO:0019219	0.372	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.781	nuclear lumen
GO:0005654	0.716	nucleoplasm
GO:0005737	0.420	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]