StarFunc result for job id Q2TB90

User Input

>input (917 residues)
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEGKMCINTEWGGFGDNGCIDDI
WTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1qhaA	0.909	0.923	0.000	903	0.697	0.708	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.
2	PDB:5hfuB	0.714	0.728	0.000	897	0.665	0.680	5hfuB.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
3	AFDB:O08528	0.944	0.944	0.000	917	0.678	0.678	O08528.pdb.gz	HXK2_MOUSE Hexokinase-2 OS=Mus musculus OX=10090 GN=Hk2 PE=1 SV=1
4	AFDB:P17710	0.954	0.899	0.000	974	0.687	0.647	P17710.pdb.gz	HXK1_MOUSE Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3
5	AFDB:Q2TB90	1.000	1.000	0.000	917	1.000	1.000	Q2TB90.pdb.gz	HKDC1_HUMAN Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1 PE=1 SV=3
6	AFDB:Q8AYP7	0.968	0.969	0.000	916	0.685	0.686	Q8AYP7.pdb.gz	Q8AYP7_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK2 PE=2 SV=1
7	AFDB:Q8AYP8	0.977	0.977	0.000	917	0.732	0.732	Q8AYP8.pdb.gz	Q8AYP8_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK1 PE=2 SV=1
8	PDB:2nztB	0.934	0.987	2.502E-103	867	0.647	0.684	2nztB.pdb.gz	The catalytic inactivation of the N-half of human hexokinase 2 and structural and biochemical characterization of its mitochondrial conformation.
9	PDB:5hg1A	0.783	0.823	4.539E-99	867	0.650	0.687	5hg1A.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
10	AFDB:P52790	0.932	0.926	1.018E-96	923	0.529	0.525	P52790.pdb.gz	HXK3_HUMAN Hexokinase-3 OS=Homo sapiens OX=9606 GN=HK3 PE=1 SV=2
11	AFDB:P27926	0.753	0.749	4.524E-94	924	0.514	0.510	P27926.pdb.gz	HXK3_RAT Hexokinase-3 OS=Rattus norvegicus OX=10116 GN=Hk3 PE=1 SV=1
12	AFDB:P17712	0.490	0.960	1.607E-49	465	0.256	0.505	P17712.pdb.gz	HXK4_RAT Hexokinase-4 OS=Rattus norvegicus OX=10116 GN=Gck PE=1 SV=2
13	AFDB:O93314	0.495	0.958	1.677E-48	471	0.255	0.497	O93314.pdb.gz	O93314_ONCMY Phosphotransferase OS=Oncorhynchus mykiss OX=8022 GN=GK PE=2 SV=2
14	AFDB:A0A5F9ZHE0	0.490	0.918	3.770E-48	486	0.257	0.486	A0A5F9ZHE0.pdb.gz	A0A5F9ZHE0_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
15	PDB:3idhA	0.478	0.958	5.539E-45	453	0.254	0.514	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
16	PDB:4dchA	0.402	0.802	2.678E-37	434	0.241	0.509	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
17	PDB:6jj7A	0.448	0.863	1.189E-31	465	0.186	0.368	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex
18	PDB:4qs7A	0.445	0.876	2.353E-31	455	0.172	0.347	4qs7A.pdb.gz	Biochemical and structural study of Arabidopsis hexokinase 1
19	PDB:3b8aX	0.457	0.873	3.309E-31	470	0.174	0.340	3b8aX.pdb.gz	Crystal structure of yeast hexokinase PI in complex with glucose: A classical "induced fit" example revised.
20	PDB:1ig8A	0.433	0.808	3.759E-29	469	0.174	0.341	1ig8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PB90	0.0	1299	889	0.660	0.681	E9PB90_HUMAN hexokinase OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=1
2	O08528	0.0	1338	917	0.679	0.679	HXK2_MOUSE Hexokinase-2 OS=Mus musculus OX=10090 GN=Hk2 PE=1 SV=1
3	P05708	0.0	1375	918	0.700	0.699	HXK1_RAT Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 PE=1 SV=4
4	P17710	0.0	1351	974	0.688	0.648	HXK1_MOUSE Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3
5	P19367	0.0	1394	917	0.709	0.709	HXK1_HUMAN Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 SV=3
6	P27881	0.0	1340	917	0.679	0.679	HXK2_RAT Hexokinase-2 OS=Rattus norvegicus OX=10116 GN=Hk2 PE=1 SV=1
7	P27926	0.0	967	924	0.514	0.510	HXK3_RAT Hexokinase-3 OS=Rattus norvegicus OX=10116 GN=Hk3 PE=1 SV=1
8	P52789	0.0	1338	917	0.676	0.676	HXK2_HUMAN Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2
9	P52790	0.0	960	923	0.526	0.522	HXK3_HUMAN Hexokinase-3 OS=Homo sapiens OX=9606 GN=HK3 PE=1 SV=2
10	Q2TB90	0.0	1885	917	1.000	1.000	HKDC1_HUMAN Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1 PE=1 SV=3
11	Q3TRM8	0.0	943	922	0.517	0.514	HXK3_MOUSE Hexokinase-3 OS=Mus musculus OX=10090 GN=Hk3 PE=1 SV=2
12	Q8AYP7	0.0	1345	916	0.685	0.686	Q8AYP7_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK2 PE=2 SV=1
13	Q8AYP8	0.0	1425	917	0.734	0.734	Q8AYP8_CHICK hexokinase OS=Gallus gallus OX=9031 GN=HK1 PE=2 SV=1
14	Q91W97	0.0	1737	915	0.911	0.913	HKDC1_MOUSE Hexokinase HKDC1 OS=Mus musculus OX=10090 GN=Hkdc1 PE=2 SV=1
15	P52792	2.91e-167	497	465	0.258	0.510	HXK4_MOUSE Hexokinase-4 OS=Mus musculus OX=10090 GN=Gck PE=1 SV=1
16	A0A5F9ZGW4	6.90e-167	496	456	0.257	0.518	A0A5F9ZGW4_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
17	P17712	7.12e-167	496	465	0.257	0.508	HXK4_RAT Hexokinase-4 OS=Rattus norvegicus OX=10116 GN=Gck PE=1 SV=2
18	P35557	1.74e-166	495	465	0.257	0.508	HXK4_HUMAN Hexokinase-4 OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1
19	Q53Y25	1.74e-166	495	465	0.257	0.508	Q53Y25_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=2 SV=1
20	A0A5F9ZHE0	9.07e-161	481	486	0.256	0.484	A0A5F9ZHE0_HUMAN Phosphotransferase OS=Homo sapiens OX=9606 GN=GCK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00349 Hexokinase_1	2.2e-133	453.7	Hexokinase
2	PF03727 Hexokinase_2	2.2e-157	533.2	Hexokinase
3	PF00282 Pyridoxal_deC	1.4e+02	12.6	Pyridoxal-dependent decarboxylase conserved domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405573	0.977	Glucose-6-phosphate isomerase
2	9606.ENSP00000364486	0.964	Fructose-1,6-bisphosphatase isozyme 2
3	9606.ENSP00000408025	0.956	Fructose-1,6-bisphosphatase 1
4	9606.ENSP00000318318	0.949	Mannose-6-phosphate isomerase
5	9606.ENSP00000360124	0.946	Phosphoglucomutase-1
6	9606.ENSP00000402103	0.945	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
7	9606.ENSP00000377192	0.941	Glucose-6-phosphate 1-dehydrogenase
8	9606.ENSP00000292432	0.935	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
9	9606.ENSP00000216410	0.932	Glucosamine-phosphate N-acetyltransferase 1
10	9606.ENSP00000349860	0.926	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
11	9606.ENSP00000473348	0.925	GDH/6PGL endoplasmic bifunctional protein
12	9606.ENSP00000253778	0.924	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
13	9606.ENSP00000267814	0.924	Sorbitol dehydrogenase
14	9606.ENSP00000295448	0.923	Glucosamine-6-phosphate deaminase 2
15	9606.ENSP00000423674	0.923	Glucosamine-6-phosphate isomerase 1
16	9606.ENSP00000269848	0.914	ATP-dependent 6-phosphofructokinase, liver type
17	9606.ENSP00000370517	0.913	ATP-dependent 6-phosphofructokinase, platelet type
18	9606.ENSP00000371393	0.913	Phosphoglucomutase-2
19	9606.ENSP00000455561	0.913	Uncharacterized protein
20	9606.ENSP00000264382	0.909	Sucrase-isomaltase, intestinal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004340	0.999	glucokinase activity
GO:0005488	0.987	binding
GO:0005515	0.967	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:1901135	0.985	carbohydrate derivative metabolic process
GO:0006796	0.969	phosphate-containing compound metabolic process
GO:0019637	0.966	organophosphate metabolic process
GO:0044238	0.940	primary metabolic process
GO:0044281	0.842	small molecule metabolic process
GO:0005975	0.764	carbohydrate metabolic process
GO:0033500	0.753	carbohydrate homeostasis
GO:0005996	0.706	monosaccharide metabolic process
GO:0006807	0.563	nitrogen compound metabolic process
GO:0019318	0.495	hexose metabolic process
GO:0016052	0.475	carbohydrate catabolic process
GO:1901564	0.409	organonitrogen compound metabolic process
GO:0042593	0.390	glucose homeostasis
GO:0006725	0.388	cellular aromatic compound metabolic process
GO:0065007	0.385	biological regulation
GO:1901360	0.368	organic cyclic compound metabolic process
GO:0046483	0.368	heterocycle metabolic process
GO:0055086	0.357	nucleobase-containing small molecule metabolic process
GO:0051156	0.316	glucose 6-phosphate metabolic process
GO:0019752	0.310	carboxylic acid metabolic process
GO:0006091	0.305	generation of precursor metabolites and energy
GO:0032787	0.303	monocarboxylic acid metabolic process
GO:0016310	0.302	phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.991	mitochondrion
GO:0005829	0.972	cytosol
GO:0016020	0.308	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17825	0.999	ATP + D-glucose = ADP + D-glucose 6-phosphate + H(+)
EC:2.7.1.2	0.999	glucokinase.

[back to server]