StarFunc result for job id Q2TBA0

User Input

>input (621 residues)
MALGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRAGEREFPCHRLVLAACSPYFRA
RFLAEPERAGELHLEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTIC
VSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDADFLGLSADELIAI
ISSDGLNVEKEEAVFEAVMRWAGSGDAEAQAERQRALPTVFESVRCRLLPRAFLESRVER
HPLVRAQPELLRKVQMVKDAHEGRITTLRKKKKGKDGAGAKEADKGTSKAKAEEDEEAER
ILPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSNQVPKNHVSLVTKENQ
VFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGR
EIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKM
CVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPF
EAFPQERSSLSLVSLVGTLYAIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREI
AYAAGATFLPVRLNVLCLTKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K5H9	0.984	0.984	0.000	621	0.995	0.995	A8K5H9.pdb.gz	A8K5H9_HUMAN cDNA FLJ76839, highly similar to Homo sapiens kelch repeat and BTB (POZ) domain containing 5 (KBTBD5), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:B3DIV9	0.907	0.920	3.455E-80	612	0.578	0.587	B3DIV9.pdb.gz	KL40A_DANRE Kelch-like protein 40a OS=Danio rerio OX=7955 GN=klhl40a PE=2 SV=2
3	AFDB:E9QJ30	0.905	0.910	4.885E-80	618	0.572	0.574	E9QJ30.pdb.gz	KL40B_DANRE Kelch-like protein 40b OS=Danio rerio OX=7955 GN=klhl40b PE=2 SV=1
4	AFDB:A2AUC9	0.889	0.910	4.402E-76	606	0.504	0.517	A2AUC9.pdb.gz	KLH41_MOUSE Kelch-like protein 41 OS=Mus musculus OX=10090 GN=Klhl41 PE=1 SV=1
5	AFDB:F1QEG2	0.902	0.925	4.390E-74	605	0.477	0.489	F1QEG2.pdb.gz	KL41B_DANRE Kelch-like protein 41b OS=Danio rerio OX=7955 GN=klhl41b PE=2 SV=1
6	AFDB:E9QIN8	0.872	0.903	4.962E-73	599	0.462	0.479	E9QIN8.pdb.gz	KL41A_DANRE Kelch-like protein 41a OS=Danio rerio OX=7955 GN=klhl41a PE=2 SV=1
7	AFDB:Q8NFY9	0.555	0.571	4.658E-44	601	0.251	0.260	Q8NFY9.pdb.gz	KBTB8_HUMAN Kelch repeat and BTB domain-containing protein 8 OS=Homo sapiens OX=9606 GN=KBTBD8 PE=1 SV=2
8	AFDB:Q9VUU5	0.436	0.435	1.727E-42	623	0.251	0.250	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
9	AFDB:A0A1B8YAB1	0.528	0.540	4.208E-42	606	0.269	0.276	A0A1B8YAB1.pdb.gz	KBTB8_XENTR Kelch repeat and BTB domain-containing protein 8 OS=Xenopus tropicalis OX=8364 GN=kbtbd8 PE=3 SV=1
10	AFDB:Q9Y2M5	0.415	0.423	4.646E-42	609	0.253	0.258	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
11	PDB:2uvkB	0.346	0.596	1.918E-13	349	0.074	0.132	2uvkB.pdb.gz
12	PDB:5gq0A	0.351	0.614	6.289E-13	338	0.095	0.175	5gq0A.pdb.gz
13	PDB:5gqtA	0.352	0.455	1.084E-12	470	0.087	0.115	5gqtA.pdb.gz
14	PDB:2zwaB	0.337	0.309	5.014E-10	683	0.084	0.076	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6oemB	0.291	0.477	2.560E-7	346	0.064	0.116	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
16	PDB:7mk2A	0.206	0.345	1.447E-6	354	0.087	0.153	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
17	PDB:1n6dA	0.298	0.191	3.357E-6	1023	0.043	0.026	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
18	PDB:6dbjD	0.288	0.469	3.527E-6	352	0.058	0.102	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
19	PDB:7mq8SG	0.235	0.344	3.894E-6	389	0.068	0.108	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5y31B	0.259	0.304	5.506E-6	511	0.045	0.055	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AUC9	0.0	658	606	0.502	0.515	KLH41_MOUSE Kelch-like protein 41 OS=Mus musculus OX=10090 GN=Klhl41 PE=1 SV=1
2	A8K5H9	0.0	1269	621	0.995	0.995	A8K5H9_HUMAN cDNA FLJ76839, highly similar to Homo sapiens kelch repeat and BTB (POZ) domain containing 5 (KBTBD5), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
3	B3DIV9	0.0	752	612	0.581	0.590	KL40A_DANRE Kelch-like protein 40a OS=Danio rerio OX=7955 GN=klhl40a PE=2 SV=2
4	E9QIN8	0.0	615	599	0.462	0.479	KL41A_DANRE Kelch-like protein 41a OS=Danio rerio OX=7955 GN=klhl41a PE=2 SV=1
5	E9QJ30	0.0	727	618	0.573	0.576	KL40B_DANRE Kelch-like protein 40b OS=Danio rerio OX=7955 GN=klhl40b PE=2 SV=1
6	F1QEG2	0.0	625	605	0.481	0.494	KL41B_DANRE Kelch-like protein 41b OS=Danio rerio OX=7955 GN=klhl41b PE=2 SV=1
7	O60662	0.0	666	606	0.504	0.517	KLH41_HUMAN Kelch-like protein 41 OS=Homo sapiens OX=9606 GN=KLHL41 PE=1 SV=2
8	Q2TBA0	0.0	1278	621	1.000	1.000	KLH40_HUMAN Kelch-like protein 40 OS=Homo sapiens OX=9606 GN=KLHL40 PE=1 SV=2
9	Q9D783	0.0	1183	621	0.923	0.923	KLH40_MOUSE Kelch-like protein 40 OS=Mus musculus OX=10090 GN=Klhl40 PE=1 SV=1
10	Q9ER30	0.0	657	606	0.499	0.512	KLH41_RAT Kelch-like protein 41 OS=Rattus norvegicus OX=10116 GN=Klhl41 PE=1 SV=1
11	A0A1B8YAB1	3.96e-59	210	606	0.280	0.287	KBTB8_XENTR Kelch repeat and BTB domain-containing protein 8 OS=Xenopus tropicalis OX=8364 GN=kbtbd8 PE=3 SV=1
12	Q9Y2M5	3.92e-53	194	609	0.256	0.261	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
13	Q8K430	1.25e-51	190	640	0.262	0.255	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
14	Q6TDP4	1.87e-51	190	642	0.264	0.255	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
15	Q9VEN5	6.34e-51	190	744	0.248	0.207	Q9VEN5_DROME Keap1, isoform A OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=3 SV=1
16	Q7KSF5	7.44e-51	190	776	0.248	0.198	Q7KSF5_DROME FI11917p OS=Drosophila melanogaster OX=7227 GN=Keap1 PE=2 SV=1
17	Q8IXQ5	9.66e-49	181	586	0.232	0.246	KLHL7_HUMAN Kelch-like protein 7 OS=Homo sapiens OX=9606 GN=KLHL7 PE=1 SV=2
18	Q6TFL4	1.03e-48	181	600	0.246	0.255	KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens OX=9606 GN=KLHL24 PE=1 SV=1
19	Q08BL9	7.69e-48	179	599	0.232	0.240	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
20	Q53G59	1.26e-47	177	568	0.235	0.257	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	2.5e-21	87.0	BTB And C-terminal Kelch
2	PF00651 BTB	2.3e-24	97.2	BTB/POZ domain
3	PF01344 Kelch_1	9.5e-28	106.8	Kelch motif
4	PF07646 Kelch_2	2.7e-06	38.4	Kelch motif
5	PF13415 Kelch_3	5e-08	44.3	Galactose oxidase, central domain
6	PF13418 Kelch_4	5.4e-14	63.2	Galactose oxidase, central domain
7	PF13854 Kelch_5	0.0029	28.6	Kelch motif
8	PF13964 Kelch_6	2.4e-16	70.5	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287777

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414670	0.969	Leiomodin-3
2	9606.ENSP00000264414	0.920	Cullin-3
3	9606.ENSP00000388723	0.914	Kelch repeat and BTB domain-containing protein 13
4	9606.ENSP00000484342	0.910	Nebulin
5	9606.ENSP00000284669	0.836	Kelch-like protein 41
6	9606.ENSP00000351933	0.802	Kelch-like protein 9
7	9606.ENSP00000216225	0.773	E3 ubiquitin-protein ligase RBX1
8	9606.ENSP00000370671	0.770	Kelch-like protein 42
9	9606.ENSP00000278317	0.768	Troponin T, fast skeletal muscle
10	9606.ENSP00000476795	0.765	Gigaxonin
11	9606.ENSP00000377001	0.764	Speckle-type POZ protein
12	9606.ENSP00000280098	0.763	Speckle-type POZ protein-like
13	9606.ENSP00000215739	0.762	Leucine-zipper-like transcriptional regulator 1
14	9606.ENSP00000312397	0.760	Kelch-like protein 3
15	9606.ENSP00000343273	0.760	Kelch-like protein 7
16	9606.ENSP00000443191	0.757	Kelch-like protein 13
17	9606.ENSP00000209884	0.751	Kelch-like protein 20
18	9606.ENSP00000395012	0.749	Kelch-like protein 24
19	9606.ENSP00000356230	0.746	Kelch-like protein 12
20	9606.ENSP00000424198	0.744	Kelch-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0009987	0.975	cellular process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.969	primary metabolic process
GO:0043170	0.954	macromolecule metabolic process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0019941	0.944	modification-dependent protein catabolic process
GO:0050794	0.941	regulation of cellular process
GO:0061061	0.932	muscle structure development
GO:0006511	0.927	ubiquitin-dependent protein catabolic process
GO:0016567	0.924	protein ubiquitination
GO:0010498	0.898	proteasomal protein catabolic process
GO:0032434	0.879	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0048513	0.874	animal organ development
GO:1903052	0.867	positive regulation of proteolysis involved in protein catabolic process
GO:1903322	0.851	positive regulation of protein modification by small protein conjugation or removal
GO:0031396	0.827	regulation of protein ubiquitination
GO:0031398	0.824	positive regulation of protein ubiquitination
GO:0032436	0.801	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0048519	0.794	negative regulation of biological process
GO:0048523	0.773	negative regulation of cellular process
GO:0009888	0.743	tissue development
GO:0007519	0.728	skeletal muscle tissue development
GO:0048869	0.702	cellular developmental process
GO:0009895	0.694	negative regulation of catabolic process
GO:0051248	0.677	negative regulation of protein metabolic process
GO:0030154	0.675	cell differentiation
GO:0048468	0.672	cell development
GO:1903051	0.666	negative regulation of proteolysis involved in protein catabolic process
GO:0031330	0.659	negative regulation of cellular catabolic process
GO:0035914	0.644	skeletal muscle cell differentiation
GO:2000059	0.537	negative regulation of ubiquitin-dependent protein catabolic process
GO:0042692	0.428	muscle cell differentiation
GO:0055001	0.420	muscle cell development
GO:0032501	0.410	multicellular organismal process
GO:0051146	0.398	striated muscle cell differentiation
GO:0043161	0.389	proteasome-mediated ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0032991	0.998	protein-containing complex
GO:0030016	0.978	myofibril
GO:0031461	0.965	cullin-RING ubiquitin ligase complex
GO:0031463	0.963	Cul3-RING ubiquitin ligase complex
GO:0005829	0.959	cytosol
GO:0030017	0.898	sarcomere
GO:0043227	0.469	membrane-bounded organelle
GO:0043231	0.443	intracellular membrane-bounded organelle
GO:0005634	0.370	nucleus
GO:0005856	0.355	cytoskeleton
GO:0031672	0.313	A band

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]