StarFunc result for job id Q2UY09

User Input

>input (1125 residues)
MWNRYFVFYLLLLSAFTSQTVSGQRKKGPKSNLLARKSDVQGSICFIDIVFIVDSSESSK
IALFDKQKDFVDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQK
VKSMNLIGQGTFSYYAISNATRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARI
SGISFITIALSTVVNEAKLRLISGDSSSEPTLLLSDPTLVDKIQDRLDILFEKKCERKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAGERGPGGIPGYKGDKGERGEC
GKPGIKGDKGSPGPYGPKGPRGIQGITGPPGDPGPKGFQGNKGEPGPPGPYGSPGAPGIG
QQGIKGERGQEGRPGAPGPIGVGEPGQPGPRGPEGVPGERGLPGEGFPGPKGEKGSEGPT
GPQGLQGLSIKGEKGDIGPVGPQGPMGIPGIGSQGEQGIQGPIGPPGPQGPAGQGLPGSK
GEVGQMGPTGPRGPVGIGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLPGARGPEG
PPGKGQPGPKGDEGKKGSKGNQGQRGLPGPEGPKGEPGIMGPFGMPGTSIPGPPGPKGDR
GGPGIPGFKGEPGLSIRGPKGVQGPRGPVGAPGLKGDGYPGVPGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPSGPRGVGTQGPKGDTGQKGLPGPPGPPGYGSQGIKGEQGPQGF
PGPKGTMGHGLPGQKGEHGERGDVGKKGDKGEIGEPGSPGKQGLQGPKGDLGLTKEEIIK
LITEICGCGPKCKETPLELVFVIDSSESVGPENFQIIKNFVKTMADRVALDLATARIGII
NYSHKVEKVANLKQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFEDARPGVKKVAL
VITDGQTDSRDKEKLTEVVKNASDTNVEIFVIGVVKKNDPNFEIFHKEMNLIATDPEHVY
QFDDFFTLQDTLKQKLFQKICEDFDSYLVQIFGSSSPQPGFGMSGEELSESTPEPQKEIS
ESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGN
CGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETCIQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2UY09	1.000	1.000	0.000	1125	1.000	1.000	Q2UY09.pdb.gz	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
2	AFDB:G4SNP7	0.144	0.115	4.748E-14	1427	0.124	0.098	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
3	PDB:4nehA	0.146	0.151	3.752E-13	1084	0.045	0.047	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
4	PDB:4nenA	0.143	0.151	1.158E-11	1063	0.048	0.051	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
5	PDB:2xwbF	0.149	0.229	1.391E-8	714	0.040	0.063	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
6	PDB:7zs96	0.144	0.393	1.508E-7	383	0.028	0.084	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
7	AFDB:E9Q7P1	0.147	0.105	2.462E-7	1613	0.277	0.193	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
8	PDB:7ena2	0.133	0.360	3.606E-7	385	0.023	0.068	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
9	PDB:6gym6	0.139	0.422	3.822E-7	335	0.023	0.078	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
10	PDB:7ad8D	0.133	0.484	1.027E-6	280	0.028	0.114	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
11	PDB:6orbA	0.141	0.050	1.946E-6	3352	0.026	0.009	6orbA.pdb.gz
12	PDB:6ujaB	0.132	0.379	1.946E-6	359	0.032	0.100	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
13	PDB:6jp8F	0.133	0.152	2.317E-6	973	0.029	0.034	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
14	AFDB:Q54SK5	0.090	0.048	6.918E-5	2388	0.116	0.054	Q54SK5.pdb.gz	DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum OX=44689 GN=dhkM PE=3 SV=1
15	AFDB:A0A0R4IR54	0.144	0.101	2.959E-4	1622	0.275	0.191	A0A0R4IR54.pdb.gz
16	AFDB:O95487	0.124	0.112	2.014E-3	1268	0.108	0.096	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
17	AFDB:A0A0B4KF25	0.096	0.095	6.982E-2	1131	0.100	0.100	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
18	AFDB:Q14993	0.031	0.030	1.249E-1	1142	0.251	0.247	Q14993.pdb.gz	COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens OX=9606 GN=COL19A1 PE=1 SV=3
19	AFDB:Q8CB87	0.077	0.084	1.487E-1	973	0.104	0.120	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
20	AFDB:A0A0B4KFM5	0.087	0.088	1.670E-1	1111	0.095	0.096	A0A0B4KFM5.pdb.gz	A0A0B4KFM5_DROME Reduction in Cnn dots 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2UY09	0.0	2187	1125	1.000	1.000	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
2	Q2UY11	0.0	1629	1141	0.863	0.851	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
3	A0MSJ1	7.12e-58	221	1658	0.229	0.156	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
4	Q17RW2	3.57e-54	209	1714	0.232	0.152	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
5	A2AX52	3.26e-52	204	2309	0.160	0.078	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
6	P12110	2.13e-51	199	1019	0.186	0.205	CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2 PE=1 SV=4
7	Q9VMV5	1.08e-49	195	1940	0.258	0.149	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
8	Q30D77	9.65e-49	192	1733	0.229	0.149	COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus OX=10090 GN=Col24a1 PE=2 SV=2
9	A0A8I5ZTZ9	1.39e-48	190	973	0.181	0.210	A0A8I5ZTZ9_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=1 SV=1
10	F1LNH3	1.87e-48	190	1038	0.181	0.197	F1LNH3_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=4 SV=3
11	A0A8I5Y5R7	2.23e-48	189	926	0.181	0.220	A0A8I5Y5R7_RAT Collagen type VI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col6a2 PE=1 SV=1
12	F1Q6P3	2.28e-48	189	1007	0.174	0.195	F1Q6P3_DANRE Collagen alpha-1(VI) chain OS=Danio rerio OX=7955 GN=col6a1 PE=1 SV=2
13	O18407	2.85e-48	191	1761	0.257	0.164	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
14	Q02788	3.66e-48	189	1034	0.179	0.194	CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus OX=10090 GN=Col6a2 PE=1 SV=3
15	P08120	6.70e-48	189	1779	0.244	0.154	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
16	C7DZK3	1.67e-47	188	1783	0.231	0.146	CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio OX=7955 GN=col27a1a PE=2 SV=1
17	Q05504	9.76e-47	184	959	0.189	0.222	Q05504_MOUSE Collagen alpha 3 chain type VI (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
18	E7FCV8	6.59e-46	182	1015	0.164	0.182	E7FCV8_DANRE Collagen alpha-2(VI) chain isoform X4 OS=Danio rerio OX=7955 GN=col6a2 PE=1 SV=3
19	O88493	1.24e-44	179	2657	0.190	0.081	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
20	P02466	1.61e-44	178	1372	0.228	0.187	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1.1e-60	212.5	Collagen triple helix repeat (20 copies)
2	PF00014 Kunitz_BPTI	6.8e-11	53.6	Kunitz/Bovine pancreatic trypsin inhibitor domain
3	PF17643 TssR	38	13.8	Type VI secretion system, TssR
4	PF00092 VWA	2.2e-55	199.1	von Willebrand factor type A domain
5	PF13519 VWA_2	4.5e-26	103.0	von Willebrand factor type A domain
6	PF13768 VWA_3	0.00029	32.3	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263556	0.903	Prolyl 4-hydroxylase subunit alpha-1
2	9606.ENSP00000384999	0.903	Prolyl 4-hydroxylase subunit alpha-2
3	9606.ENSP00000401749	0.903	Prolyl 4-hydroxylase subunit alpha-3
4	9606.ENSP00000236040	0.690	Prolyl 3-hydroxylase 1
5	9606.ENSP00000316881	0.690	Prolyl 3-hydroxylase 2
6	9606.ENSP00000323696	0.690	Cartilage-associated protein
7	9606.ENSP00000354960	0.683	Procollagen galactosyltransferase 2
8	9606.ENSP00000434412	0.679	Serpin H1
9	9606.ENSP00000283351	0.672	Trafficking protein particle complex subunit 8
10	9606.ENSP00000300026	0.662	Peptidyl-prolyl cis-trans isomerase B
11	9606.ENSP00000282903	0.648	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
12	9606.ENSP00000196061	0.629	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
13	9606.ENSP00000223127	0.629	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
14	9606.ENSP00000327801	0.625	Protein disulfide-isomerase
15	9606.ENSP00000256194	0.624	[F-actin]-monooxygenase MICAL2
16	9606.ENSP00000478600	0.624	Prolyl 3-hydroxylase 3
17	9606.ENSP00000261405	0.608	Von Willebrand factor
18	9606.ENSP00000252599	0.600	Procollagen galactosyltransferase 1
19	9606.ENSP00000262551	0.568	Mimecan
20	9606.ENSP00000412940	0.517	FRAS1-related extracellular matrix protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	0.999	extracellular matrix structural constituent conferring tensile strength
GO:0044877	0.998	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050896	0.786	response to stimulus
GO:0032501	0.764	multicellular organismal process
GO:0065007	0.743	biological regulation
GO:0050789	0.674	regulation of biological process
GO:0032502	0.668	developmental process
GO:0048856	0.638	anatomical structure development
GO:0050794	0.477	regulation of cellular process
GO:0007275	0.434	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005783	0.973	endoplasmic reticulum
GO:0005788	0.943	endoplasmic reticulum lumen
GO:0016020	0.388	membrane
GO:0032991	0.387	protein-containing complex
GO:0031981	0.317	nuclear lumen
GO:0005615	0.310	extracellular space
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]