StarFunc result for job id Q2V2M9

User Input

>input (1422 residues)
MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCT
LQLSHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSG
RDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVD
GMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYSESNAPLLIQAVTAVDTKRG
VKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQR
HLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRR
RSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQVRDLREKYSNFGNNSYHSSRPSSGSSVP
TTPTSSVSPPQEARLERSSPSGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNK
FRYKYLEQLAAEEHEKELRSRSVSRGRADLSLDLTSPAAPACLAPLSHSPSSSDSQEALT
VSASSPGTPHHPQASAGDPEPESEAEPEAEAGAGQVADEAGQDIASAHEGAETEVEQALE
QEPEERASLSEKERQNEGVNERDNCSASSVSSSSSTLEREEKEDKLSRDRTTGLWPAGVQ
DAGVNGQCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEAGRTQQEAEAVASLATRISTL
QANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPNDKVPETAPVQP
KTESDYIWDQLMANPRELRIQDMDFTDLGEEDDIDVLDVDLGHREAPGPPPPPPPTFLGL
PPPPPPPLLDSIPPPPVPGNLLVPPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNE
VRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIV
LDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKILTMIPTDEEKQKIQEAQL
ANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENN
KTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDS
SDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLKQRMSEFLK
DCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERV
LQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTS
SPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTDDAADEIMDRIVKSATQVPSQR
VVPRERKRSRANRKSLRRTLKSGLTPEEARALGLVGTSELQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LQJ2	0.418	0.381	0.000	1578	0.900	0.811	F1LQJ2.pdb.gz	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
2	AFDB:Q2V2M9	1.000	1.000	0.000	1422	1.000	1.000	Q2V2M9.pdb.gz	FHOD3_HUMAN FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2
3	AFDB:Q9Y613	0.313	0.377	2.841E-78	1164	0.415	0.507	Q9Y613.pdb.gz	FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3
4	AFDB:Q6P9Q4	0.316	0.370	7.338E-78	1197	0.408	0.485	Q6P9Q4.pdb.gz	FHOD1_MOUSE FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3
5	AFDB:M9NFP9	0.281	0.341	9.268E-74	1152	0.397	0.490	M9NFP9.pdb.gz	M9NFP9_DROME Formin homology 2 domain containing, isoform G OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
6	AFDB:Q9SE97	0.202	0.269	5.781E-16	1051	0.144	0.195	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
7	AFDB:Q9JL04	0.201	0.183	7.888E-14	1578	0.127	0.114	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
8	AFDB:Q9NZ56	0.206	0.172	8.236E-14	1722	0.120	0.099	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
9	AFDB:Q3ULZ2	0.232	0.283	1.394E-11	1149	0.103	0.128	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
10	AFDB:Q9C0D6	0.230	0.282	8.905E-11	1143	0.097	0.121	Q9C0D6.pdb.gz	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
11	PDB:6tgbB	0.155	0.288	7.136E-5	680	0.037	0.076	6tgbB.pdb.gz
12	PDB:2z6gA	0.121	0.282	4.758E-4	550	0.027	0.069	2z6gA.pdb.gz
13	PDB:7anwA	0.088	0.180	1.080E-3	645	0.025	0.054	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
14	PDB:5tbkA	0.104	0.270	2.670E-3	417	0.025	0.084	5tbkA.pdb.gz
15	PDB:1b3uA	0.059	0.117	3.313E-3	588	0.020	0.048	1b3uA.pdb.gz
16	PDB:3tpoA	0.113	0.308	3.313E-3	438	0.021	0.068	3tpoA.pdb.gz
17	PDB:1wa5B	0.127	0.345	7.517E-3	466	0.029	0.088	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
18	PDB:4tnmA	0.122	0.391	7.517E-3	407	0.022	0.076	4tnmA.pdb.gz
19	PDB:6kbnC	0.127	0.333	1.261E-2	504	0.023	0.063	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
20	PDB:7dvqK	0.097	0.582	1.375E-2	188	0.019	0.144	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LQJ2	0.0	1585	1578	0.627	0.565	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
2	Q2V2M9	0.0	2929	1422	1.000	1.000	FHOD3_HUMAN FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2
3	Q6P9Q4	0.0	582	1197	0.213	0.253	FHOD1_MOUSE FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3
4	Q76LL6	0.0	1592	1578	0.628	0.566	FHOD3_MOUSE FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1
5	Q9Y613	0.0	585	1164	0.214	0.262	FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3
6	M9NFP9	2.24e-179	566	1152	0.210	0.259	M9NFP9_DROME Formin homology 2 domain containing, isoform G OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
7	Q8T4F5	2.63e-178	565	1211	0.210	0.246	Q8T4F5_DROME SD08909p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
8	Q9VSQ1	1.20e-176	566	1393	0.210	0.214	Q9VSQ1_DROME Formin homology 2 domain containing, isoform A OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
9	M9NE63	2.77e-173	552	1205	0.205	0.241	M9NE63_DROME Formin homology 2 domain containing, isoform F OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
10	M9ND66	7.95e-173	563	1744	0.208	0.170	M9ND66_DROME Formin homology 2 domain containing, isoform H OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
11	M9MRS9	1.45e-171	552	1387	0.206	0.211	M9MRS9_DROME Formin homology 2 domain containing, isoform E OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
12	E1JI78	3.66e-170	566	2528	0.208	0.117	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
13	M9MSK7	1.22e-167	545	1509	0.203	0.191	M9MSK7_DROME Formin homology 2 domain containing, isoform D OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
14	Q8SY43	6.54e-158	513	1294	0.176	0.193	Q8SY43_DROME LD24110p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
15	Q9VSQ0	6.54e-158	513	1294	0.176	0.193	Q9VSQ0_DROME FI03664p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=2
16	A0A0K3AU72	4.91e-96	343	1698	0.143	0.120	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
17	P48608	1.60e-22	107	1091	0.051	0.067	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
18	Q1ZXK2	2.38e-21	103	1074	0.072	0.096	FORG_DICDI Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1
19	Q54N00	3.64e-20	100	1087	0.053	0.070	FORH_DICDI Formin-H OS=Dictyostelium discoideum OX=44689 GN=forH PE=1 SV=1
20	Q9NZ56	2.26e-19	97.8	1722	0.085	0.070	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06371 Drf_GBD	87	14.1	Diaphanous GTPase-binding Domain
2	PF02181 FH2	9.8e-93	322.9	Formin Homology 2 Domain
3	PF18382 Formin_GBD_N	3.3e-49	177.5	Formin N-terminal GTPase-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000041274

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000001770	0.587	Tetratricopeptide repeat domain 22
2	9544.ENSMMUP00000008242	0.548	Nestin
3	9544.ENSMMUP00000015115	0.539	Striatin 3
4	9544.ENSMMUP00000003717	0.537	Profilin
5	9544.ENSMMUP00000033080	0.526	Uncharacterized protein
6	9544.ENSMMUP00000033763	0.526	Uncharacterized protein
7	9544.ENSMMUP00000040537	0.526	Cell division control protein 42 homolog isoform 2
8	9544.ENSMMUP00000030714	0.523	Profilin 2
9	9544.ENSMMUP00000027741	0.516	Uncharacterized protein
10	9544.ENSMMUP00000002412	0.508	Uncharacterized protein
11	9544.ENSMMUP00000041024	0.508	Uncharacterized protein
12	9544.ENSMMUP00000029607	0.503	Formin like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.605	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.978	multicellular organismal process
GO:0033043	0.970	regulation of organelle organization
GO:0032502	0.969	developmental process
GO:0048856	0.962	anatomical structure development
GO:0016043	0.960	cellular component organization
GO:0051493	0.930	regulation of cytoskeleton organization
GO:0009653	0.924	anatomical structure morphogenesis
GO:0048468	0.899	cell development
GO:0048522	0.888	positive regulation of cellular process
GO:0051130	0.878	positive regulation of cellular component organization
GO:0030036	0.875	actin cytoskeleton organization
GO:0044087	0.870	regulation of cellular component biogenesis
GO:0032956	0.861	regulation of actin cytoskeleton organization
GO:1902903	0.857	regulation of supramolecular fiber organization
GO:0110053	0.843	regulation of actin filament organization
GO:0007275	0.746	multicellular organism development
GO:0048731	0.738	system development
GO:0097435	0.703	supramolecular fiber organization
GO:0010638	0.676	positive regulation of organelle organization
GO:0051495	0.664	positive regulation of cytoskeleton organization
GO:1902905	0.561	positive regulation of supramolecular fiber organization
GO:0050896	0.474	response to stimulus
GO:0048513	0.472	animal organ development
GO:0009888	0.411	tissue development
GO:0045785	0.360	positive regulation of cell adhesion
GO:0010811	0.353	positive regulation of cell-substrate adhesion
GO:1900026	0.302	positive regulation of substrate adhesion-dependent cell spreading

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005856	0.905	cytoskeleton
GO:0005634	0.875	nucleus
GO:0015629	0.747	actin cytoskeleton
GO:0099080	0.707	supramolecular complex
GO:0099512	0.398	supramolecular fiber
GO:0048471	0.323	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]