StarFunc result for job id Q2VIQ3

User Input

>input (1234 residues)
MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGETQVVVGTDKSFTYDFVFDPCTE
QEEVFNKAVAPLIKGIFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGIIPRVIQ
LLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKT
VLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKSDKNCSFRSKLHLVD
LAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGSFVPYRDSKLTRLLQDS
LGGNSHTLMIACVSPADSNLEETLSTLRYADRARKIKNKPIVNIDPHTAELNHLKQQVQQ
LQVLLLQAHGGTLPGSINAEPSENLQSLMEKNQSLVEENEKLSRCLSKAAGQTAQMLERI
ILTEQVNEKLNAKLEELRQHVACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDET
VACTAAAIDTAVEEEAQVETSPETSRSSDAFTTQHALHQAQMSKEVVELNNALALKEALV
RKMTQNDNQLQPIQFQYQDNIKNLELEVINLQKEKEELVRELQTAKKNVNQAKLSEHRHK
LLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIWMMKNQRVQLMRQMKEDAEK
FRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSSVLRRKTEEAAAANKRLKDALQK
QREVTDKRKETQSHGKEGIAARVRNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVVQ
LKEKKESRENPPPKLRKCTFSLSEVHGQVLESEDCITKQIESLETEMELRSAQIADLQQK
LLDAESEDRPKQCWENIATILEAKCALKYLIGELVSSKIHVTKLENSLRQSKASCADMQK
MLFEEQNHFSEIETELQAELVRMEQQHQEKVLYLVSQLQESQMAEKQLEKSASEKEQQLV
STLQCQDEELEKMREVCEQNQQLLQENEIIKQKLILLQVASRQKHLPNDTLLSPDSSFEY
IPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDGDSDEGDDEEWKPTKLVKV
SRKNIQGCSCKGWCGNKQCGCRKQKSDCGVDCSCDPTKCRNRQQGKDSLGTVEQTQDSEG
SFKLEDPTEVTPGLSFFNPVCATPNSKILKEMCDMEQVLSKKTAPAPSPFDLPESKHGAT
EYQQNKPPGKKKKRALASNTSFFSGCSPIEEEAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33174	0.652	0.654	0.000	1231	0.835	0.838	P33174.pdb.gz	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
2	AFDB:Q2VIQ3	1.000	1.000	0.000	1234	1.000	1.000	Q2VIQ3.pdb.gz	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
3	AFDB:Q9XZ29	0.513	0.521	3.452E-68	1212	0.324	0.330	Q9XZ29.pdb.gz	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
4	AFDB:O45935	0.272	0.309	1.107E-53	1083	0.257	0.293	O45935.pdb.gz	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
5	AFDB:Q86VH2	0.286	0.253	2.440E-52	1401	0.259	0.228	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
6	AFDB:B7ZNG0	0.270	0.248	8.115E-48	1348	0.255	0.234	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
7	AFDB:Q6S003	0.287	0.190	2.994E-46	1873	0.275	0.181	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
8	AFDB:Q382E5	0.270	0.298	1.122E-37	1115	0.205	0.227	Q382E5.pdb.gz	Q382E5_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5490 PE=3 SV=1
9	AFDB:Q6RZZ9	0.271	0.264	2.560E-37	1265	0.202	0.197	Q6RZZ9.pdb.gz	KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum OX=44689 GN=kif13 PE=1 SV=1
10	AFDB:Q99PT9	0.265	0.326	3.313E-37	997	0.196	0.243	Q99PT9.pdb.gz	KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2
11	PDB:7wrgA	0.255	0.383	7.407E-29	812	0.133	0.202	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.247	0.384	1.632E-27	783	0.126	0.199	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.221	0.399	4.651E-23	670	0.091	0.167	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5w3sA	0.043	0.087	7.363E-2	485	0.017	0.043	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
15	PDB:7d6dA	0.063	0.171	5.787E-1	380	0.042	0.137	7d6dA.pdb.gz
16	PDB:1mkfA	0.037	0.080	6.416E-1	371	0.006	0.022	1mkfA.pdb.gz
17	PDB:5njbB	0.042	0.078	6.416E-1	445	0.023	0.063	5njbB.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.
18	PDB:7ungA0	0.091	0.384	6.416E-1	220	0.033	0.186	7ungA0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:5ye5A	0.037	0.081	8.302E-1	464	0.012	0.032	5ye5A.pdb.gz
20	PDB:5xzrA	0.045	0.092	9.203E-1	519	0.008	0.019	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95239	0.0	2296	1232	0.938	0.939	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
2	P33174	0.0	2045	1231	0.837	0.839	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
3	Q2VIQ3	0.0	2526	1234	1.000	1.000	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
4	Q9XZ29	5.12e-176	554	1212	0.326	0.332	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
5	Q6YUL8	1.09e-162	514	1035	0.285	0.340	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
6	A0A068FIK2	2.93e-157	499	1033	0.282	0.337	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
7	Q8GS71	1.90e-156	498	1035	0.280	0.334	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
8	F4K0J3	1.39e-155	502	1300	0.279	0.265	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
9	O45935	1.83e-122	407	1083	0.242	0.276	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
10	A0A1B0GV47	1.45e-109	380	1653	0.173	0.129	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
11	Q7Z4S6	2.26e-109	380	1674	0.173	0.128	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
12	Q9QXL1	4.88e-109	379	1668	0.169	0.125	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
13	O75037	1.66e-108	377	1637	0.169	0.128	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
14	Q86VH2	2.88e-104	362	1401	0.152	0.133	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
15	Q7M6Z4	6.27e-103	358	1394	0.161	0.143	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
16	Q58G59	4.82e-95	335	1363	0.140	0.127	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
17	Q2M1P5	7.58e-94	332	1343	0.137	0.126	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
18	B7ZNG0	1.13e-93	331	1348	0.137	0.125	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
19	P46873	2.46e-93	317	699	0.139	0.245	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
20	A0A8I6GCQ1	2.26e-89	305	674	0.139	0.255	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	3.4e-112	386.3	Kinesin motor domain
2	PF16796 Microtub_bd	2.6e-17	74.7	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387875

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260363	0.932	Kinesin-like protein KIF23
2	9606.ENSP00000260731	0.923	Kinesin-like protein KIF11
3	9606.ENSP00000160827	0.899	Kinesin-like protein KIF22
4	9606.ENSP00000404190	0.896	Rac GTPase-activating protein 1
5	9606.ENSP00000302530	0.885	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000377793	0.877	Protein regulator of cytokinesis 1
7	9606.ENSP00000378295	0.860	Inner centromere protein
8	9606.ENSP00000378356	0.860	Kinesin-like protein KIF20A
9	9606.ENSP00000265148	0.846	Centromere-associated protein E
10	9606.ENSP00000356379	0.846	Abnormal spindle-like microcephaly-associated protein
11	9606.ENSP00000300093	0.843	Serine/threonine-protein kinase PLK1
12	9606.ENSP00000480987	0.834	DNA replication licensing factor MCM3
13	9606.ENSP00000411532	0.831	DNA topoisomerase 2-alpha
14	9606.ENSP00000287598	0.825	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
15	9606.ENSP00000442068	0.825	Cell division cycle-associated protein 3
16	9606.ENSP00000300403	0.824	Targeting protein for Xklp2
17	9606.ENSP00000216122	0.816	DNA replication licensing factor MCM5
18	9606.ENSP00000286398	0.815	Structural maintenance of chromosomes protein 2
19	9606.ENSP00000378699	0.811	Cyclin-dependent kinase 1
20	9606.ENSP00000216911	0.780	Aurora kinase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.995	ATP-dependent activity
GO:0003774	0.990	cytoskeletal motor activity
GO:0003777	0.867	microtubule motor activity
GO:0008092	0.383	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007017	0.991	microtubule-based process
GO:0016043	0.990	cellular component organization
GO:0006996	0.968	organelle organization
GO:0007049	0.966	cell cycle
GO:0022402	0.954	cell cycle process
GO:0098813	0.929	nuclear chromosome segregation
GO:0007052	0.924	mitotic spindle organization
GO:0051276	0.918	chromosome organization
GO:0000070	0.913	mitotic sister chromatid segregation
GO:0051225	0.875	spindle assembly
GO:0090307	0.854	mitotic spindle assembly
GO:0000910	0.809	cytokinesis
GO:0061640	0.802	cytoskeleton-dependent cytokinesis
GO:0051231	0.693	spindle elongation
GO:0000281	0.689	mitotic cytokinesis
GO:0050789	0.597	regulation of biological process
GO:0000022	0.591	mitotic spindle elongation
GO:0050794	0.529	regulation of cellular process
GO:0051179	0.413	localization
GO:0051641	0.335	cellular localization
GO:0051234	0.334	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0015630	0.939	microtubule cytoskeleton
GO:0032991	0.400	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]