StarFunc result for job id Q2VIR3

User Input

>input (472 residues)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGT
KGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGI
VSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41091	0.996	0.996	1.768E-99	472	0.985	0.985	P41091.pdb.gz	IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3
2	AFDB:O64490	0.970	0.984	6.663E-85	465	0.682	0.692	O64490.pdb.gz	O64490_ARATH protein-synthesizing GTPase OS=Arabidopsis thaliana OX=3702 GN=EIF2 PE=1 SV=1
3	AFDB:P32481	0.939	0.841	7.759E-82	527	0.684	0.613	P32481.pdb.gz	IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD11 PE=1 SV=1
4	AFDB:Q09130	0.933	0.987	7.759E-82	446	0.699	0.740	Q09130.pdb.gz	IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif213 PE=2 SV=1
5	AFDB:Q382L1	0.940	0.930	6.850E-69	477	0.508	0.503	Q382L1.pdb.gz	Q382L1_TRYB2 Eukaryotic translation initiation factor 2 gamma, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4830 PE=4 SV=1
6	AFDB:Q8U082	0.829	0.950	1.676E-57	411	0.409	0.470	Q8U082.pdb.gz	IF2G_PYRFU Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2g PE=1 SV=1
7	PDB:6fyxk	0.819	0.929	1.782E-57	414	0.650	0.742	6fyxk.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
8	AFDB:Q980A5	0.839	0.952	1.126E-56	415	0.381	0.434	Q980A5.pdb.gz	IF2G_SACS2 Translation initiation factor 2 subunit gamma OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eif2g PE=1 SV=1
9	PDB:7qp6t	0.704	0.923	3.249E-54	356	0.735	0.975	7qp6t.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
10	PDB:3j81k	0.738	0.949	4.187E-49	365	0.581	0.751	3j81k.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
11	PDB:7a09Y	0.779	0.881	1.148E-48	414	0.835	0.952	7a09Y.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
12	PDB:2dcuA	0.754	0.866	1.208E-47	407	0.409	0.474	2dcuA.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
13	PDB:7d43P	0.715	0.791	5.130E-45	421	0.877	0.983	7d43P.pdb.gz	ISRIB Blunts the Integrated Stress Response by Allosterically Antagonising the Inhibitory Effect of Phosphorylated eIF2 on eIF2B.
14	AFDB:A0A384ME17	0.668	0.692	1.168E-31	455	0.225	0.233	A0A384ME17.pdb.gz	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
15	AFDB:C2E605	0.664	0.783	2.163E-31	396	0.220	0.263	C2E605.pdb.gz	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
16	AFDB:P14081	0.634	0.495	2.692E-30	614	0.199	0.153	P14081.pdb.gz	SELB_ECOLI Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) OX=83333 GN=selB PE=1 SV=3
17	PDB:3qsyA	0.595	0.661	5.607E-30	415	0.373	0.424	3qsyA.pdb.gz	Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
18	PDB:7a5gZ	0.668	0.793	1.279E-26	394	0.203	0.244	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
19	PDB:5lzbz	0.618	0.483	1.017E-25	614	0.199	0.153	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
20	PDB:1ob2A	0.646	0.767	2.228E-25	393	0.206	0.247	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O64490	0.0	675	465	0.682	0.692	O64490_ARATH protein-synthesizing GTPase OS=Arabidopsis thaliana OX=3702 GN=EIF2 PE=1 SV=1
2	P32481	0.0	682	527	0.684	0.613	IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD11 PE=1 SV=1
3	P41091	0.0	950	472	0.985	0.985	IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3
4	P81795	0.0	948	472	0.983	0.983	IF2G_RAT Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Rattus norvegicus OX=10116 GN=Eif2s3 PE=1 SV=2
5	Q09130	0.0	694	446	0.701	0.742	IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif213 PE=2 SV=1
6	Q9Z0N1	0.0	946	472	0.981	0.981	IF2G_MOUSE Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus OX=10090 GN=Eif2s3x PE=1 SV=2
7	Q382L1	2.02e-171	492	477	0.508	0.503	Q382L1_TRYB2 Eukaryotic translation initiation factor 2 gamma, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4830 PE=4 SV=1
8	Q8U082	2.04e-122	365	411	0.417	0.479	IF2G_PYRFU Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2g PE=1 SV=1
9	Q980A5	2.34e-115	347	415	0.390	0.443	IF2G_SACS2 Translation initiation factor 2 subunit gamma OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eif2g PE=1 SV=1
10	P45975	2.12e-29	123	635	0.136	0.101	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
11	P50062	3.06e-20	94.7	394	0.176	0.211	EFTU_BORBU Elongation factor Tu OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=tuf PE=3 SV=1
12	C2E605	8.70e-19	90.1	396	0.176	0.210	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
13	Q74JU6	8.70e-19	90.1	396	0.176	0.210	EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=tuf PE=3 SV=1
14	Q388R1	1.50e-18	90.1	470	0.199	0.200	Q388R1_TRYB2 Elongation factor TU, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0070 PE=4 SV=1
15	P49410	3.57e-18	89.0	452	0.165	0.173	EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus OX=9913 GN=TUFM PE=1 SV=1
16	P85834	4.36e-18	88.6	452	0.163	0.170	EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1
17	Q8BFR5	4.52e-18	88.6	452	0.163	0.170	EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1
18	A0A384ME17	6.43e-18	88.2	455	0.161	0.167	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
19	P49411	6.43e-18	88.2	455	0.161	0.167	EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=3
20	Q9JHW4	1.59e-17	87.4	583	0.186	0.151	SELB_MOUSE Selenocysteine-specific elongation factor OS=Mus musculus OX=10090 GN=Eefsec PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09173 eIF2_C	7.2e-31	117.6	Initiation factor eIF2 gamma, C terminal
2	PF00503 G-alpha	2e+02	12.5	G-protein alpha subunit
3	PF00009 GTP_EFTU	7.4e-19	79.6	Elongation factor Tu GTP binding domain
4	PF03144 GTP_EFTU_D2	9.9e-08	43.6	Elongation factor Tu domain 2
5	PF01926 MMR_HSR1	14	17.2	50S ribosome-binding GTPase
6	PF16897 MMR_HSR1_Xtn	40	15.6	C-terminal region of MMR_HSR1 domain
7	PF03193 RsgA_GTPase	8.1	17.8	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.983	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000364119	0.967	Eukaryotic translation initiation factor 2 subunit 2
3	9606.ENSP00000417229	0.928	Eukaryotic translation initiation factor 2A
4	9606.ENSP00000354125	0.926	Eukaryotic translation initiation factor 3 subunit B
5	9606.ENSP00000353575	0.914	Translation initiation factor eIF-2B subunit gamma
6	9606.ENSP00000355890	0.914	Bifunctional glutamate/proline--tRNA ligase
7	9606.ENSP00000273783	0.913	Translation initiation factor eIF-2B subunit epsilon
8	9606.ENSP00000278572	0.906	40S ribosomal protein S3
9	9606.ENSP00000358140	0.905	Eukaryotic translation initiation factor 3 subunit A
10	9606.ENSP00000266126	0.903	Translation initiation factor eIF-2B subunit beta
11	9606.ENSP00000416250	0.896	Translation initiation factor eIF-2B subunit alpha
12	9606.ENSP00000253108	0.886	Eukaryotic translation initiation factor 3 subunit G
13	9606.ENSP00000394869	0.886	Translation initiation factor eIF-2B subunit delta
14	9606.ENSP00000341247	0.874	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
15	9606.ENSP00000216554	0.863	Eukaryotic translation initiation factor 5
16	9606.ENSP00000281141	0.844	Cell division cycle protein 123 homolog
17	9606.ENSP00000332604	0.837	Eukaryotic translation initiation factor 3 subunit C
18	9606.ENSP00000370258	0.837	Eukaryotic translation initiation factor 3 subunit C-like protein
19	9606.ENSP00000307940	0.836	Elongation factor 2
20	9606.ENSP00000331901	0.826	Elongation factor 1-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	0.999	translation initiation factor activity
GO:0003824	0.979	catalytic activity
GO:0016817	0.959	hydrolase activity, acting on acid anhydrides
GO:0017111	0.949	ribonucleoside triphosphate phosphatase activity
GO:0050839	0.906	cell adhesion molecule binding
GO:0045296	0.862	cadherin binding
GO:0003924	0.809	GTPase activity
GO:0003723	0.800	RNA binding
GO:0043167	0.363	ion binding
GO:0036094	0.351	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0010467	0.996	gene expression
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0006413	0.987	translational initiation
GO:0065007	0.591	biological regulation
GO:0050789	0.548	regulation of biological process
GO:0050794	0.507	regulation of cellular process
GO:0019222	0.369	regulation of metabolic process
GO:0002181	0.350	cytoplasmic translation
GO:0060255	0.331	regulation of macromolecule metabolic process
GO:0031323	0.304	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043227	0.993	membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0032991	0.990	protein-containing complex
GO:0005829	0.983	cytosol
GO:0005576	0.956	extracellular region
GO:0043232	0.898	intracellular non-membrane-bounded organelle
GO:0031982	0.869	vesicle
GO:0070013	0.869	intracellular organelle lumen
GO:0005615	0.858	extracellular space
GO:0070062	0.851	extracellular exosome
GO:0016020	0.847	membrane
GO:0043231	0.823	intracellular membrane-bounded organelle
GO:0005634	0.752	nucleus
GO:0031981	0.333	nuclear lumen
GO:0005654	0.322	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.959	Acting on acid anhydrides.
RHEA:23680	0.949	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.949	nucleoside-triphosphate phosphatase.
RHEA:19669	0.809	GTP + H2O = GDP + H(+) + phosphate

[back to server]