StarFunc result for job id Q2VPJ9

User Input

>input (315 residues)
MGARLGRRAGPEAGSEAGAAAGCGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQD
LGLERTLLPDILYRDVAFLNPVDPISHDLLVNLARDLQCPKKDYELWKSSDKICRQLIYH
LTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETVDLSGIPLSTQDVQHITRYLSSHGA
VLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPA
LAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDS
TAAGLGPEPQACCAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q57VI9	0.271	0.173	9.785E-6	545	0.190	0.110	Q57VI9.pdb.gz	Q57VI9_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.540 PE=4 SV=1
2	AFDB:Q5JTD7	0.324	0.323	4.347E-5	316	0.092	0.092	Q5JTD7.pdb.gz	LRC73_HUMAN Leucine-rich repeat-containing protein 73 OS=Homo sapiens OX=9606 GN=LRRC73 PE=1 SV=1
3	AFDB:Q38CF8	0.324	0.297	5.131E-5	345	0.092	0.084	Q38CF8.pdb.gz	Q38CF8_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7350 PE=4 SV=1
4	AFDB:Q38C46	0.334	0.082	6.400E-5	1405	0.117	0.026	Q38C46.pdb.gz	Q38C46_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5860 PE=4 SV=1
5	AFDB:Q38D82	0.338	0.075	6.400E-5	1578	0.105	0.021	Q38D82.pdb.gz	Q38D82_TRYB2 Flagellar Member 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4280 PE=4 SV=1
6	AFDB:Q9PUQ6	0.312	0.290	1.175E-4	343	0.108	0.099	Q9PUQ6.pdb.gz	Q9PUQ6_DANRE Sk-tropomodulin OS=Danio rerio OX=7955 GN=Sk-Tmod PE=1 SV=1
7	AFDB:Q57ZJ1	0.279	0.230	1.312E-4	395	0.098	0.078	Q57ZJ1.pdb.gz	Q57ZJ1_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.130 PE=4 SV=1
8	AFDB:Q3UHZ5	0.305	0.188	1.730E-4	550	0.102	0.058	Q3UHZ5.pdb.gz	LMOD2_MOUSE Leiomodin-2 OS=Mus musculus OX=10090 GN=Lmod2 PE=1 SV=1
9	AFDB:Q8I7M7	0.310	0.168	1.730E-4	639	0.137	0.067	Q8I7M7.pdb.gz	Q8I7M7_CAEEL Tropomodulin OS=Caenorhabditis elegans OX=6239 GN=tmd-2 PE=1 SV=3
10	AFDB:P70566	0.329	0.299	2.041E-4	351	0.102	0.091	P70566.pdb.gz	TMOD2_RAT Tropomodulin-2 OS=Rattus norvegicus OX=10116 GN=Tmod2 PE=1 SV=1
11	PDB:5wfnC	0.260	0.386	1.065E-3	193	0.070	0.114	5wfnC.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
12	PDB:4rwtD	0.285	0.314	1.850E-3	280	0.102	0.114	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
13	PDB:1a4yA	0.288	0.208	3.397E-3	460	0.095	0.065	1a4yA.pdb.gz
14	PDB:7pzcA	0.264	0.088	1.686E-2	1010	0.092	0.029	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
15	PDB:6o60C	0.229	0.188	3.271E-2	389	0.102	0.082	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
16	PDB:6ylgb	0.158	0.096	6.005E-2	613	0.127	0.065	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
17	PDB:4kxfP	0.273	0.107	9.341E-2	866	0.067	0.024	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
18	PDB:1k5dC	0.307	0.284	1.043E-1	344	0.102	0.093	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
19	PDB:6npyA	0.239	0.106	1.165E-1	798	0.086	0.034	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
20	PDB:7lfhA	0.228	0.093	1.453E-1	806	0.083	0.032	7lfhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VXH4	0.27	35.4	476	0.076	0.050	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
2	Q2LKU9	0.33	35.4	1182	0.092	0.025	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
3	Q2LKV2	0.33	35.0	906	0.095	0.033	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
4	P0DUQ2	0.38	34.7	478	0.076	0.050	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
5	Q385C8	0.44	35.0	1454	0.102	0.022	Q385C8_TRYB2 MIF4G domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4270 PE=4 SV=1
6	Q2LKV5	0.47	34.7	1172	0.095	0.026	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
7	Q2LKW6	0.47	34.7	1233	0.095	0.024	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
8	Q9LYN8	0.67	34.3	1192	0.067	0.018	EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana OX=3702 GN=EMS1 PE=1 SV=1
9	D9I2F9	0.93	33.9	1218	0.114	0.030	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
10	D9I2G3	0.93	33.9	1218	0.114	0.030	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
11	D9I2G4	0.94	33.9	1218	0.114	0.030	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
12	A1Z198	0.96	33.9	1177	0.086	0.023	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
13	D9I2G1	0.99	33.9	1218	0.114	0.030	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
14	D9I2H0	1.0	33.9	1218	0.114	0.030	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
15	Q0GKD5	1.0	33.5	1196	0.095	0.025	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
16	A0A087WWI0	1.8	32.3	226	0.127	0.177	A0A087WWI0_HUMAN Leucine rich melanocyte differentiation associated OS=Homo sapiens OX=9606 GN=LRMDA PE=1 SV=1
17	C0LGT6	1.8	32.7	1031	0.133	0.041	EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana OX=3702 GN=EFR PE=1 SV=1
18	Q3UP24	2.1	32.7	1024	0.098	0.030	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
19	Q7TT16	2.1	32.3	396	0.076	0.061	IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus OX=10090 GN=Ipmk PE=1 SV=1
20	O24496	2.6	32.0	258	0.152	0.186	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320520

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277570	0.806	Proline and serine rich 2
2	9606.ENSP00000442478	0.653	Stomatin-like protein 1
3	9606.ENSP00000261007	0.587	Acetylcholine receptor subunit alpha
4	9606.ENSP00000257915	0.556	Alpha-globin transcription factor CP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.967	cellular process
GO:0050789	0.967	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0071704	0.637	organic substance metabolic process
GO:0044238	0.522	primary metabolic process
GO:0006807	0.498	nitrogen compound metabolic process
GO:0044237	0.498	cellular metabolic process
GO:0043170	0.470	macromolecule metabolic process
GO:0032502	0.425	developmental process
GO:0032501	0.392	multicellular organismal process
GO:0048856	0.392	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.996	organelle
GO:0005829	0.987	cytosol
GO:0043229	0.980	intracellular organelle
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0032991	0.917	protein-containing complex
GO:0016020	0.637	membrane
GO:0005634	0.522	nucleus
GO:0043228	0.476	non-membrane-bounded organelle
GO:0043232	0.449	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]