StarFunc result for job id Q2VPK5

User Input

>input (515 residues)
MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFR
AMLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACG
QSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDS
FLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEE
LLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGD
VVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPST
VSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSP
IPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLP
PYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2VPK5	1.000	1.000	3.700E-84	515	1.000	1.000	Q2VPK5.pdb.gz	CTU2_HUMAN Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2 PE=1 SV=1
2	AFDB:O65628	0.600	0.670	3.395E-19	458	0.233	0.262	O65628.pdb.gz	CTU2_ARATH Cytoplasmic tRNA 2-thiolation protein 2 OS=Arabidopsis thaliana OX=3702 GN=CTU2 PE=2 SV=3
3	AFDB:Q9UUC7	0.544	0.751	5.028E-16	366	0.173	0.243	Q9UUC7.pdb.gz	CTU2_SCHPO Cytoplasmic tRNA 2-thiolation protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctu2 PE=1 SV=1
4	AFDB:Q7Z7A3	0.479	0.691	2.186E-15	348	0.159	0.236	Q7Z7A3.pdb.gz	CTU1_HUMAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1
5	AFDB:Q99J10	0.477	0.579	2.660E-15	420	0.167	0.205	Q99J10.pdb.gz	CTU1_MOUSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Mus musculus OX=10090 GN=Ctu1 PE=2 SV=1
6	AFDB:Q38AA3	0.485	0.724	4.341E-15	336	0.122	0.188	Q38AA3.pdb.gz	Q38AA3_TRYB2 Cytoplasmic tRNA 2-thiolation protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1850 PE=3 SV=1
7	AFDB:P53088	0.486	0.680	3.399E-14	359	0.128	0.184	P53088.pdb.gz	CTU1_YEAST Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCS6 PE=1 SV=3
8	AFDB:Q94480	0.490	0.684	3.569E-14	360	0.118	0.169	Q94480.pdb.gz	CTU1_DICDI Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum OX=44689 GN=ctu1 PE=2 SV=2
9	AFDB:O76365	0.449	0.603	4.789E-14	373	0.130	0.180	O76365.pdb.gz	CTU1_CAEEL Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis elegans OX=6239 GN=tut-1 PE=1 SV=1
10	AFDB:O94282	0.450	0.670	1.712E-13	335	0.118	0.182	O94282.pdb.gz	CTU1_SCHPO Cytoplasmic tRNA 2-thiolation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ncs6 PE=1 SV=1
11	PDB:1ni5A	0.312	0.367	1.426E-5	433	0.087	0.104	1ni5A.pdb.gz
12	PDB:1wxiA	0.231	0.389	1.499E-3	261	0.089	0.176	1wxiA.pdb.gz	Structures of Escherichia coli NAD Synthetase with Substrates and Products Reveal Mechanistic Rearrangements
13	PDB:2oq2C	0.248	0.442	4.403E-3	257	0.072	0.144	2oq2C.pdb.gz	Crystal structure of Saccharomyces cerevisiae 3'-phosphoadenosine-5'-phosphosulfate reductase complexed with adenosine 3',5'-bisphosphate.
14	PDB:2detA	0.204	0.277	2.698E-2	365	0.078	0.110	2detA.pdb.gz	Snapshots of tRNA sulphuration via an adenylated intermediate
15	PDB:3seqA	0.237	0.194	5.102E-2	661	0.083	0.065	3seqA.pdb.gz	Regulation of the intersubunit ammonia tunnel in Mycobacterium tuberculosis glutamine-dependent NAD+ synthetase.
16	PDB:3uowB	0.120	0.128	7.929E-2	477	0.039	0.042	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
17	PDB:1gpmA	0.135	0.138	8.327E-2	501	0.047	0.048	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
18	PDB:3x44A	0.107	0.158	1.117E-1	321	0.054	0.087	3x44A.pdb.gz	The structural and mutational analyses of O-ureido-L-serine synthase necessary for D-cycloserine biosynthesis.
19	PDB:1zunA	0.233	0.519	1.359E-1	204	0.058	0.147	1zunA.pdb.gz	Molecular basis for g protein control of the prokaryotic ATP sulfurylase.
20	PDB:2bhtA	0.111	0.181	1.574E-1	294	0.035	0.061	2bhtA.pdb.gz	Structure of the O-Acetylserine Sulfhydrylase Isoenzyme Cysm from Escherichia Coli

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2VPK5	0.0	1054	515	1.000	1.000	CTU2_HUMAN Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2 PE=1 SV=1
2	Q9UUC7	8.80e-09	59.7	366	0.076	0.107	CTU2_SCHPO Cytoplasmic tRNA 2-thiolation protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctu2 PE=1 SV=1
3	O65628	1.66e-08	59.3	458	0.093	0.105	CTU2_ARATH Cytoplasmic tRNA 2-thiolation protein 2 OS=Arabidopsis thaliana OX=3702 GN=CTU2 PE=2 SV=3
4	P53923	1.71e-07	56.2	493	0.206	0.215	CTU2_YEAST Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCS2 PE=1 SV=1
5	O94282	1.34e-05	49.7	335	0.066	0.101	CTU1_SCHPO Cytoplasmic tRNA 2-thiolation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ncs6 PE=1 SV=1
6	Q38AA3	0.014	40.0	336	0.054	0.083	Q38AA3_TRYB2 Cytoplasmic tRNA 2-thiolation protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1850 PE=3 SV=1
7	P53088	0.029	39.3	359	0.066	0.095	CTU1_YEAST Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCS6 PE=1 SV=3
8	Q7Z7A3	0.045	38.5	348	0.074	0.109	CTU1_HUMAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1
9	Q99J10	0.046	38.5	420	0.066	0.081	CTU1_MOUSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Mus musculus OX=10090 GN=Ctu1 PE=2 SV=1
10	Q94480	0.13	37.0	360	0.052	0.075	CTU1_DICDI Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum OX=44689 GN=ctu1 PE=2 SV=2
11	D4GSH6	0.94	34.3	321	0.066	0.106	NCSA_HALVD tRNA 2-thiolation protein NcsA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=ncsA PE=1 SV=1
12	F4JY37	1.1	34.7	1366	0.035	0.013	RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana OX=3702 GN=RUK PE=1 SV=1
13	P06467	1.4	32.7	142	0.070	0.254	HBAZ_MOUSE Hemoglobin subunit zeta OS=Mus musculus OX=10090 GN=Hbz PE=2 SV=2
14	Q91W40	1.8	33.5	508	0.039	0.039	KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus OX=10090 GN=Klc3 PE=1 SV=1
15	Q7L4I2	2.8	33.1	434	0.043	0.051	RSRC2_HUMAN Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1
16	Q2MKA7	3.1	32.3	263	0.068	0.133	RSPO1_HUMAN R-spondin-1 OS=Homo sapiens OX=9606 GN=RSPO1 PE=1 SV=1
17	Q9P7T8	4.8	32.7	1717	0.033	0.010	YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC694.02 PE=3 SV=1
18	Q38EI1	6.7	32.0	1351	0.060	0.023	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
19	Q965W2	8.7	31.6	407	0.021	0.027	NHR86_CAEEL Nuclear hormone receptor family member nhr-86 OS=Caenorhabditis elegans OX=6239 GN=nhr-86 PE=2 SV=2
20	O76365	9.0	31.2	373	0.058	0.080	CTU1_CAEEL Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis elegans OX=6239 GN=tut-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10288 CTU2	5.7e-21	86.2	Cytoplasmic tRNA 2-thiolation protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390011	0.999	Cytoplasmic tRNA 2-thiolation protein 1
2	9606.ENSP00000244051	0.996	Adenylyltransferase and sulfurtransferase MOCS3
3	9606.ENSP00000412922	0.994	Ubiquitin-related modifier 1
4	9606.ENSP00000397673	0.988	Alkylated DNA repair protein alkB homolog 8
5	9606.ENSP00000438349	0.983	Multifunctional methyltransferase subunit TRM112-like protein
6	9606.ENSP00000414851	0.877	Elongator complex protein 2
7	9606.ENSP00000363205	0.872	Cysteine desulfurase, mitochondrial
8	9606.ENSP00000216122	0.852	DNA replication licensing factor MCM5
9	9606.ENSP00000380402	0.847	3-mercaptopyruvate sulfurtransferase
10	9606.ENSP00000256398	0.845	Elongator complex protein 3
11	9606.ENSP00000363779	0.812	Elongator complex protein 1
12	9606.ENSP00000385828	0.784	Thiosulfate sulfurtransferase
13	9606.ENSP00000296149	0.781	Elongator complex protein 6
14	9606.ENSP00000360676	0.766	KTI12 chromatin associated homolog
15	9606.ENSP00000379267	0.749	Elongator complex protein 4
16	9606.ENSP00000314441	0.746	tRNA (guanine-N(7)-)-methyltransferase
17	9606.ENSP00000361475	0.734	Neuronal calcium sensor 1
18	9606.ENSP00000264670	0.700	tRNA (cytosine(34)-C(5))-methyltransferase
19	9606.ENSP00000419599	0.693	DPH3 homolog
20	9606.ENSP00000401191	0.687	Probable 18S rRNA (guanine-N(7))-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.451	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.997	macromolecule metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0008033	0.987	tRNA processing
GO:0006400	0.973	tRNA modification
GO:0002098	0.476	tRNA wobble uridine modification
GO:0034227	0.363	tRNA thio-modification
GO:1901564	0.305	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0005829	0.997	cytosol
GO:0070013	0.957	intracellular organelle lumen
GO:0031981	0.950	nuclear lumen
GO:0005654	0.679	nucleoplasm
GO:0043228	0.614	non-membrane-bounded organelle
GO:0043232	0.368	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]