StarFunc result for job id Q2VWA4

User Input

>input (1001 residues)
MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVSLVIDGQE
RLCLAQISNTLLKNFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITK
REAERLCKSFLGENRPPKLPDNFAFDVSHECAWGCRGSFIPARYNSSRAKCIKCSYCNMY
FSPNKFIFHSHRTPDAKYTQPDAANFNSWRRHLKLTDKSPQDELVFAWEDVKAMFNGGSR
KRALPQPGAHPACHPLSSVKAAAVAAAAAVAGGGGLLGPHLLGAPPPPPPPPPPLAELAG
APHAHHKRPRFDDDDDSLQEAAVVAAASLSAAAASLSVAAASGGAGTGGGGAGGGCVAGV
GVGAGAGAGAGAGAKGPRSYPVIPVPSKGSFGGVLQKFPGCGGLFPHPYTFPAAAAAFSL
CHKKEDAGAAAEALGGAGAGGAGAAPKAGLSGLFWPAGRKDAFYPPFCMFWPPRTPGGLP
VPTYLQPPPQPPSALGCALGESPALLRQAFLDLAEPGGAAGSAEAAPPPGQPPQVVANGP
GSGPPPPAGGAGSRDALFESPPGGSGGDCSAGSTPPADSVAAAGAGAAAAGSGPAGSRVP
APHHPHLLEGRKAGGGSYHHSSAFRPVGGKDDAESLAKLHGASAGAPHSAQTHPHHHHHP
HHHHHHHHPPQPPSPLLLLPPQPDEPGSERHHPAPPPPPPPPPPPPLAQHPHHRGLLSPG
GTSCCYPSEDSSEDEDDEEEEQEVDVEGHKPPEGEEEEEGRDPDDDEEEDEETEVLLGDP
LVGGGRFLQGRGPSEKGSSRDRAPAVAGAFPLGLNSSRLLQEDGKLGDPGSDLPPPPPPP
LAPQKASGGGSSSPGSPVHHPSLEEQPSYKDSQKTKENNQVIVSTKDDNSFSDKNKEHSF
FITDSDASGGDFWRERSGEHTQETNSPHSLKKDVENMGKEELQKVLFEQIDLRRRLEQEF
QVLKGNTSFPVFNNFQDQMKRELAYREEMVQQLQIVSCIST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2VWA4	0.999	0.999	0.000	1001	1.000	1.000	Q2VWA4.pdb.gz	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
2	AFDB:D1YSG4	0.225	0.289	3.541E-39	770	0.258	0.335	D1YSG4.pdb.gz	D1YSG4_DROME CORL OS=Drosophila melanogaster OX=7227 GN=fuss PE=2 SV=1
3	AFDB:F1QM29	0.039	0.031	3.964E-2	1413	0.118	0.084	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
4	AFDB:P39769	0.037	0.026	8.836E-2	1589	0.129	0.081	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
5	AFDB:Q7SZL5	0.037	0.029	1.176E-1	1338	0.113	0.084	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
6	AFDB:A0A0A0MQZ8	0.067	0.073	1.659E-1	866	0.118	0.136	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
7	AFDB:Q09847	0.040	0.034	1.756E-1	1325	0.131	0.099	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
8	AFDB:B4UN32	0.052	0.045	2.476E-1	1208	0.118	0.098	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
9	AFDB:Q02910	0.067	0.075	2.622E-1	864	0.148	0.171	Q02910.pdb.gz	CPN_DROME Calphotin OS=Drosophila melanogaster OX=7227 GN=Cpn PE=2 SV=2
10	AFDB:Q9VA36	0.047	0.053	2.777E-1	882	0.128	0.145	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
11	PDB:7by6B	0.046	0.071	1.674	606	0.011	0.018	7by6B.pdb.gz	Structural basis of malaria parasite phenylalanine tRNA-synthetase inhibition by bicyclic azetidines.
12	PDB:4nbbE	0.030	0.221	3.950	114	0.005	0.044	4nbbE.pdb.gz	Structural basis of the divergent oxygenation reactions catalyzed by the rieske nonheme iron oxygenase carbazole 1,9a-dioxygenase.
13	PDB:7nacn	0.051	0.110	3.950	425	0.009	0.021	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:3tgoD	0.040	0.141	5.898	186	0.017	0.091	3tgoD.pdb.gz
15	PDB:4tweA	0.030	0.040	5.898	706	0.012	0.017	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
16	PDB:5nrll	0.048	0.259	5.898	99	0.015	0.152	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:7db7B	0.028	0.032	5.898	836	0.008	0.010	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
18	PDB:2mxcA	0.039	0.136	6.245	172	0.015	0.087	2mxcA.pdb.gz
19	PDB:5iv5AF	0.028	0.098	6.245	218	0.013	0.060	5iv5AF.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
20	PDB:6djzB	0.030	0.089	6.245	221	0.017	0.077	6djzB.pdb.gz	Structural basis for sigma1receptor ligand recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7M7C7	0.0	1308	1008	0.899	0.893	SKOR2_MOUSE SKI family transcriptional corepressor 2 OS=Mus musculus OX=10090 GN=Skor2 PE=1 SV=1
2	Q2VWA4	0.0	1989	1015	0.994	0.980	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
3	Q8BX46	6.22e-131	421	964	0.192	0.199	SKOR1_MOUSE SKI family transcriptional corepressor 1 OS=Mus musculus OX=10090 GN=Skor1 PE=1 SV=2
4	P84550	7.77e-131	421	965	0.192	0.199	SKOR1_HUMAN SKI family transcriptional corepressor 1 OS=Homo sapiens OX=9606 GN=SKOR1 PE=1 SV=1
5	D1YSG4	2.90e-116	377	770	0.163	0.212	D1YSG4_DROME CORL OS=Drosophila melanogaster OX=7227 GN=fuss PE=2 SV=1
6	P12755	1.32e-32	138	728	0.083	0.114	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
7	Q60698	4.14e-32	136	725	0.083	0.114	SKI_MOUSE Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2
8	P17863	5.11e-32	132	437	0.080	0.183	SKI_AVIES Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1
9	A0A0G2K628	7.74e-32	135	727	0.083	0.114	A0A0G2K628_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=1 SV=2
10	A0A8I5ZYW7	1.02e-31	135	686	0.084	0.122	A0A8I5ZYW7_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=3 SV=1
11	P49140	2.70e-31	134	750	0.080	0.107	SKI_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1
12	E1BSJ7	2.73e-31	134	750	0.080	0.107	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
13	Q1ECW8	2.92e-30	130	727	0.073	0.100	Q1ECW8_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=id:ibd1250 PE=2 SV=1
14	F1P0N0	1.42e-29	128	690	0.077	0.112	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
15	Q05951	1.46e-29	128	690	0.077	0.112	Q05951_CHICK C-sno protein OS=Gallus gallus OX=9031 GN=c-sno PE=2 SV=1
16	Q60979	3.66e-28	124	674	0.076	0.113	Q60979_MOUSE SnoN protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=1
17	D3ZWL1	4.67e-28	123	677	0.076	0.112	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
18	Q60665	6.13e-28	123	675	0.076	0.113	SKIL_MOUSE Ski-like protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=2
19	A0A8I6A1B8	6.92e-28	122	551	0.081	0.147	A0A8I6A1B8_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
20	P12757	6.97e-28	123	684	0.076	0.111	SKIL_HUMAN Ski-like protein OS=Homo sapiens OX=9606 GN=SKIL PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08782 c-SKI_SMAD_bind	4.8e-28	108.5	c-SKI Smad4 binding domain
2	PF02437 Ski_Sno	1e-35	133.0	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483333

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.873	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000339637	0.716	BRCA1-associated ATM activator 1
3	9606.ENSP00000276569	0.690	Armadillo repeat containing 1
4	9606.ENSP00000353331	0.612	Kin of IRRE-like protein 2
5	9606.ENSP00000360994	0.605	AMSH-like protease
6	9606.ENSP00000418081	0.585	Voltage-dependent calcium channel subunit alpha-2/delta-2
7	9606.ENSP00000418751	0.581	BTB/POZ domain-containing protein 9
8	9606.ENSP00000300591	0.577	Lipoxygenase homology domain-containing protein 1
9	9606.ENSP00000360718	0.577	Ras-related protein Rab-3B
10	9606.ENSP00000386200	0.567	Forkhead box protein P2
11	9606.ENSP00000340226	0.561	LIM homeobox transcription factor 1-alpha
12	9606.ENSP00000178640	0.557	Dual specificity mitogen-activated protein kinase kinase 5
13	9606.ENSP00000355613	0.554	Tripartite motif-containing protein 67
14	9606.ENSP00000357591	0.554	Trafficking protein particle complex subunit 3-like protein
15	9606.ENSP00000300605	0.546	Haloacid dehalogenase like hydrolase domain containing 2
16	9606.ENSP00000365687	0.539	Pancreas transcription factor 1 subunit alpha
17	9606.ENSP00000261731	0.536	LIM/homeobox protein Lhx5
18	9606.ENSP00000457733	0.532	Calcium-binding mitochondrial carrier protein SCaMC-1
19	9606.ENSP00000478257	0.523	Cyclin-I2
20	9606.ENSP00000283233	0.521	Coiled-coil domain containing 148

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046332	1.000	SMAD binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.375	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0023051	0.977	regulation of signaling
GO:0010646	0.977	regulation of cell communication
GO:0048523	0.974	negative regulation of cellular process
GO:0048583	0.972	regulation of response to stimulus
GO:0090287	0.938	regulation of cellular response to growth factor stimulus
GO:0090092	0.938	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090101	0.907	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009987	0.629	cellular process
GO:0032501	0.499	multicellular organismal process
GO:0019222	0.402	regulation of metabolic process
GO:0031323	0.390	regulation of cellular metabolic process
GO:0060255	0.386	regulation of macromolecule metabolic process
GO:0051171	0.379	regulation of nitrogen compound metabolic process
GO:0048856	0.339	anatomical structure development
GO:0080090	0.328	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.982	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]