StarFunc result for job id Q2VWP7

User Input

>input (1150 residues)
MAPPLRPLARLRPPGMLLRALLLLLLLSPLPGVWCFSELSFVKEPQDVTVTRKDPVVLDC
QAHGEVPIKVTWLKNGAKMSENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYG
AILSQKAHLALSTISAFEVQPISTEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMD
RITALPTGVLQIYDVSQRDSGNYRCIAATVAHRRKSMEASLTVIPAKESKSFHTPTIIAG
PQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFNTRVLGNGNLMISDVRLQHAG
VYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSW
LKNGRKIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPS
APYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYII
DDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPI
PAKYRRGQVVLYRLSFRLSTENSIQVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLG
ESSVWTSHRTPKATSVKAPKSPELHLEPLNCTTISVRWQQDVEDTAAIQGYKLYYKEEGQ
QENGPIFLDTKDLLYTLSGLDPRRKYHVRLLAYNNIDDGYQADQTVSTPGCVSVRDRMVP
PPPPPHHLYAKANTSSSIFLHWRRPAFTAAQIINYTIRCNPVGLQNASLVLYLQTSETHM
LVQGLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSW
KPPDGPETVVTRYTILYASRKAWIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNE
VGEGPFSNSVELAVLPKETSESNQRPKRLDSADAKVYSGYYHLDQKSMTGIAVGVGIALT
CILICVLILIYRSKARKSSASKTAQNGTQQLPRTSASLASGNEVGKNLEGAVGNEESLMP
MIMPNSFIDAKGGTDLIINSYGPIIKNNSKKKWFFFQDSKKIQVEQPQRRFTPAVCFYQP
GTTVLISDEDSPSSPGQTTSFSRPFGVAADTEHSANSEGSHETGDSGRFSHESNDEIHLS
SVISTTPPNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2EY14	0.579	0.579	0.000	1149	0.611	0.612	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
2	AFDB:Q92859	0.318	0.253	2.557E-84	1461	0.262	0.206	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
3	AFDB:P97603	0.306	0.258	1.136E-82	1377	0.259	0.216	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
4	AFDB:Q8BQC3	0.327	0.457	1.648E-64	813	0.268	0.379	Q8BQC3.pdb.gz	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1
5	AFDB:A0A0B4K6Z6	0.139	0.084	5.312E-61	2037	0.221	0.125	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
6	AFDB:Q9Z2I4	0.157	0.134	3.785E-60	1366	0.199	0.168	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
7	AFDB:Q9UQ52	0.299	0.332	4.328E-60	1028	0.185	0.207	Q9UQ52.pdb.gz	CNTN6_HUMAN Contactin-6 OS=Homo sapiens OX=9606 GN=CNTN6 PE=1 SV=1
8	AFDB:P97528	0.306	0.339	9.242E-60	1028	0.199	0.223	P97528.pdb.gz	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	AFDB:A0A0G2JZA1	0.157	0.120	4.608E-59	1512	0.206	0.157	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
10	AFDB:D4A0Z7	0.309	0.320	5.925E-55	1108	0.203	0.211	D4A0Z7.pdb.gz	D4A0Z7_RAT BOC cell adhesion associated, oncogene regulated OS=Rattus norvegicus OX=10116 GN=Boc PE=4 SV=3
11	PDB:5oj2B	0.127	0.197	8.869E-25	692	0.103	0.172	5oj2B.pdb.gz
12	PDB:1e07A	0.131	0.198	3.979E-20	642	0.079	0.142	1e07A.pdb.gz
13	PDB:5a42A	0.110	0.088	5.116E-16	1597	0.098	0.071	5a42A.pdb.gz
14	PDB:7q5zA	0.087	0.078	6.343E-14	1344	0.071	0.061	7q5zA.pdb.gz
15	PDB:6dldD	0.124	0.458	6.632E-14	269	0.057	0.245	6dldD.pdb.gz
16	PDB:7sqcO0	0.112	0.112	7.251E-14	1140	0.084	0.085	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:7q1yA	0.097	0.085	7.928E-14	1374	0.074	0.062	7q1yA.pdb.gz
18	PDB:8eyyA	0.135	0.192	1.936E-13	775	0.054	0.080	8eyyA.pdb.gz
19	PDB:6h03A	0.091	0.087	2.766E-13	1223	0.065	0.061	6h03A.pdb.gz
20	PDB:8dtlA	0.156	0.236	4.322E-13	741	0.049	0.076	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EY14	0.0	1379	1149	0.614	0.614	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
2	Q2EY15	0.0	2128	1191	0.902	0.871	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
3	Q2VWP7	0.0	2386	1150	1.000	1.000	PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG PE=2 SV=1
4	Q8BQC3	5.19e-146	461	813	0.217	0.306	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1
5	A0A0R4IIB3	3.67e-81	293	1409	0.202	0.165	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
6	A0A0R4IP15	6.15e-80	290	1428	0.204	0.165	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
7	Q49BB0	4.09e-79	287	1421	0.213	0.172	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
8	P97603	7.35e-79	286	1377	0.210	0.176	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
9	Q91562	1.35e-76	280	1427	0.225	0.181	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
10	Q92859	2.27e-76	279	1461	0.207	0.163	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
11	P97798	1.34e-73	271	1492	0.210	0.162	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
12	P43146	5.35e-73	268	1447	0.222	0.176	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
13	Q63155	3.21e-71	263	1445	0.221	0.176	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
14	P70211	3.52e-71	263	1447	0.221	0.176	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
15	Q3S3D7	2.48e-66	248	1441	0.233	0.186	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
16	A1Z921	6.25e-61	231	1375	0.203	0.170	A1Z921_DROME Frazzled, isoform B OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
17	Q94537	1.31e-60	230	1375	0.203	0.170	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
18	A0A8I6AEM0	7.95e-52	202	1897	0.205	0.124	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
19	G5EF96	1.14e-51	201	1415	0.168	0.136	UNC40_CAEEL Netrin receptor unc-40 OS=Caenorhabditis elegans OX=6239 GN=unc-40 PE=1 SV=1
20	A0A8I6A6R5	7.39e-51	199	1920	0.205	0.123	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.3	19.9	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.00045	31.5	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	1.3e-59	209.8	Fibronectin type III domain
4	PF16893 fn3_2	0.016	26.7	Fibronectin type III domain
5	PF07679 I-set	1.3e-50	180.7	Immunoglobulin I-set domain
6	PF00047 ig	4.2e-30	115.1	Immunoglobulin domain
7	PF13895 Ig_2	2.6e-29	112.7	Immunoglobulin domain
8	PF13927 Ig_3	5.1e-51	182.5	Immunoglobulin domain
9	PF16680 Ig_4	0.2	23.6	T-cell surface glycoprotein CD3 delta chain
10	PF09294 Interfer-bind	0.097	24.3	Interferon-alpha/beta receptor, fibronectin type III
11	PF16706 Izumo-Ig	0.75	21.1	Izumo-like Immunoglobulin domain
12	PF10179 NDNF	1.6	20.2	Neuron-derived neurotrophic factor, first Fn(III) domain
13	PF16656 Pur_ac_phosph_N	1.7e-13	62.4	Purple acid Phosphatase, N-terminal domain
14	PF14292 SusE	31	16.3	SusE outer membrane protein
15	PF07686 V-set	1.5e-11	55.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384398	0.628	RNA-binding protein MEX3D
2	9606.ENSP00000349805	0.618	PAK4-inhibitor INKA2
3	9606.ENSP00000380524	0.570	Calcyphosin-like protein
4	9606.ENSP00000260443	0.560	Probable ribosome biogenesis protein RLP24
5	9606.ENSP00000443598	0.560	Protein FAM214A
6	9606.ENSP00000367880	0.545	GPI ethanolamine phosphate transferase 3
7	9606.ENSP00000385545	0.539	Kinesin-like protein KIF26B
8	9606.ENSP00000296603	0.535	Recruited to ligand-activated beta-2 adrenergic receptor/ADRB2, it negatively regulates the adrenergic receptor signaling pathway . May also regulate other G-protein coupled receptors including type-1 angiotensin II receptor/AGTR1 (Probable)
9	9606.ENSP00000263707	0.527	Transcription factor CP2-like protein 1
10	9606.ENSP00000272427	0.523	Exocyst complex component 6B
11	9606.ENSP00000471242	0.518	FERM, ARHGEF and pleckstrin domain-containing protein 1
12	9606.ENSP00000368720	0.505	Controls the stability of the leptin mRNA harboring an AU- rich element (ARE) in its 3' UTR, in cooperation with the RNA stabilizer ELAVL1 . Decreases the stability of the leptin mRNA by antagonizing the function of ELAVL1 by inducing its atypical recruitment from the nucleus to the cytosol (By similarity). Binds to cardiolipin (CL), phosphatidic acid (PA), phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylserine (PS) . Promotes apoptosis by enhancing BAX-BAK hetero-oligomerization via interaction with BID in colon cancer cells (By similarity). ECO:0000269\|PubMed:18191643, [...]
13	9606.ENSP00000343398	0.501	Transmembrane protein with metallophosphoesterase domain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.856	identical protein binding
GO:0060089	0.720	molecular transducer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0050793	0.936	regulation of developmental process
GO:0009987	0.882	cellular process
GO:0051239	0.763	regulation of multicellular organismal process
GO:0048519	0.728	negative regulation of biological process
GO:0048523	0.706	negative regulation of cellular process
GO:0050768	0.399	negative regulation of neurogenesis
GO:0048518	0.370	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.988	membrane
GO:0005886	0.965	plasma membrane
GO:0043226	0.711	organelle
GO:0043227	0.569	membrane-bounded organelle
GO:0005622	0.543	intracellular anatomical structure
GO:0005576	0.514	extracellular region
GO:0043229	0.465	intracellular organelle
GO:0005615	0.330	extracellular space
GO:0043231	0.322	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]