StarFunc result for job id Q2WGJ6

User Input

>input (581 residues)
MDEESLDGLLFKDHDFSSDLLRQLNSLRQSRILTDVSICAGAREIPCHRNVLASSSPYFR
AMFCSSFREKSEAKVQLKGIDPPTLDQIVSYVYTGEAHIATDNVLPVMEAASMLQFPKLF
EACSSYLQSQLAPSNCLGMIRLSEILSCETLKKKAREVALTSFPEVAASADLKELCALEL
RDYLGDDGLCGEEEKVFEALMVWIKHDLQARKRYMQELFKQVRLQYIHPAFFHHFIANDA
LLQSSPACQIILETAKRQMFSLCGTTVPDCKLLLHVPPRNSYQDFLILLGGRKDSQQTTR
DVLLYSKQTGQWQSLAKLPTRLYKASAITLHRSIYVLGGMAVSSGRSLVSHNVYIFSLKL
NQWRLGEPMLVARYSHRSTAHKNFIFSIGGIGEGQELMGSMERYDSICNVWESMASMPVG
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNSWFKMETRMIKNVCAPAVVLGER
IVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDS
ASFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPRTSGLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2WGJ6	1.000	1.000	0.000	581	1.000	1.000	Q2WGJ6.pdb.gz	KLH38_HUMAN Kelch-like protein 38 OS=Homo sapiens OX=9606 GN=KLHL38 PE=1 SV=3
2	AFDB:Q08BL9	0.640	0.625	6.578E-55	599	0.317	0.307	Q08BL9.pdb.gz	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
3	AFDB:Q6TFL4	0.629	0.613	8.497E-55	600	0.330	0.320	Q6TFL4.pdb.gz	KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens OX=9606 GN=KLHL24 PE=1 SV=1
4	AFDB:Q8WZ60	0.590	0.560	1.349E-53	621	0.286	0.267	Q8WZ60.pdb.gz	KLHL6_HUMAN Kelch-like protein 6 OS=Homo sapiens OX=9606 GN=KLHL6 PE=1 SV=3
5	AFDB:Q96CT2	0.514	0.353	6.941E-53	875	0.310	0.206	Q96CT2.pdb.gz	KLH29_HUMAN Kelch-like protein 29 OS=Homo sapiens OX=9606 GN=KLHL29 PE=1 SV=3
6	AFDB:E0CZ16	0.624	0.619	1.935E-51	587	0.281	0.278	E0CZ16.pdb.gz	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
7	AFDB:Q6TDP4	0.746	0.685	1.935E-51	642	0.269	0.243	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
8	AFDB:O95198	0.519	0.509	6.612E-51	593	0.269	0.263	O95198.pdb.gz	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
9	AFDB:Q9Y2M5	0.493	0.472	1.286E-50	609	0.277	0.264	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
10	AFDB:Q9P2G9	0.602	0.574	2.378E-50	620	0.238	0.223	Q9P2G9.pdb.gz	KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens OX=9606 GN=KLHL8 PE=1 SV=4
11	PDB:5gqtA	0.379	0.461	2.885E-15	470	0.095	0.117	5gqtA.pdb.gz
12	PDB:5gq0A	0.367	0.610	3.727E-15	338	0.096	0.166	5gq0A.pdb.gz
13	PDB:2uvkB	0.398	0.640	5.908E-15	349	0.086	0.143	2uvkB.pdb.gz
14	PDB:2zwaB	0.351	0.301	8.488E-12	683	0.077	0.066	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:2hqsA	0.353	0.474	6.268E-9	412	0.050	0.070	2hqsA.pdb.gz
16	PDB:5mzhB	0.263	0.343	3.959E-8	415	0.055	0.077	5mzhB.pdb.gz
17	PDB:1n6dA	0.177	0.106	5.114E-8	1023	0.062	0.035	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
18	PDB:5lcwR	0.301	0.424	6.953E-8	383	0.065	0.099	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
19	PDB:7mq8SG	0.298	0.412	1.102E-7	389	0.069	0.103	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1ri6A	0.298	0.463	1.160E-7	333	0.055	0.096	1ri6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2WGJ6	0.0	1214	581	1.000	1.000	KLH38_HUMAN Kelch-like protein 38 OS=Homo sapiens OX=9606 GN=KLHL38 PE=1 SV=3
2	Q6TFL4	4.20e-98	312	600	0.339	0.328	KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens OX=9606 GN=KLHL24 PE=1 SV=1
3	Q08BL9	1.56e-93	300	599	0.312	0.302	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
4	Q96CT2	5.57e-89	295	875	0.318	0.211	KLH29_HUMAN Kelch-like protein 29 OS=Homo sapiens OX=9606 GN=KLHL29 PE=1 SV=3
5	Q9H0H3	5.94e-85	278	589	0.325	0.321	KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens OX=9606 GN=KLHL25 PE=1 SV=1
6	Q8R2P1	2.56e-83	273	589	0.320	0.316	KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus OX=10090 GN=Klhl25 PE=1 SV=1
7	Q6V595	2.23e-81	269	619	0.299	0.281	KLHL6_MOUSE Kelch-like protein 6 OS=Mus musculus OX=10090 GN=Klhl6 PE=2 SV=2
8	Q8WZ60	1.68e-80	267	621	0.303	0.283	KLHL6_HUMAN Kelch-like protein 6 OS=Homo sapiens OX=9606 GN=KLHL6 PE=1 SV=3
9	Q2V9T0	1.98e-76	255	589	0.299	0.295	Q2V9T0_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=2 SV=1
10	Q6DKY8	2.40e-76	255	589	0.299	0.295	Q6DKY8_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=4 SV=1
11	Q9UJP4	3.10e-76	255	597	0.308	0.300	KLH21_HUMAN Kelch-like protein 21 OS=Homo sapiens OX=9606 GN=KLHL21 PE=1 SV=4
12	O14682	1.63e-75	253	589	0.298	0.294	ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens OX=9606 GN=ENC1 PE=1 SV=2
13	E0CZ16	1.61e-72	244	587	0.282	0.279	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
14	Q9UH77	4.04e-71	241	587	0.281	0.278	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
15	Q7ZT06	1.82e-68	234	589	0.286	0.282	Q7ZT06_DANRE Ectodermal-neural cortex (With BTB-like domain) OS=Danio rerio OX=7955 GN=enc1 PE=2 SV=1
16	Q9Y2M5	2.10e-66	229	609	0.287	0.274	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
17	Q53G59	5.13e-66	227	568	0.284	0.290	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
18	Q8JZP3	9.87e-66	227	593	0.270	0.265	KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus OX=10090 GN=Klhl2 PE=2 SV=1
19	O95198	1.93e-64	223	593	0.267	0.261	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
20	Q6TDP4	8.22e-63	220	642	0.269	0.243	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	4.9e-22	89.3	BTB And C-terminal Kelch
2	PF00651 BTB	3.7e-23	93.2	BTB/POZ domain
3	PF07893 DUF1668	45	14.8	Protein of unknown function (DUF1668)
4	PF01344 Kelch_1	1e-34	129.2	Kelch motif
5	PF07646 Kelch_2	4.6e-16	69.4	Kelch motif
6	PF13415 Kelch_3	2e-19	80.7	Galactose oxidase, central domain
7	PF13418 Kelch_4	2.9e-16	70.4	Galactose oxidase, central domain
8	PF13854 Kelch_5	1.6e-05	35.9	Kelch motif
9	PF13964 Kelch_6	3.1e-32	121.0	Kelch motif
10	PF13570 PQQ_3	1.1e+02	14.8	PQQ-like domain
11	PF11822 SANBR_BTB	27	16.4	SANT and BTB domain regulator of CSR, BTB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358815	0.670	E3 ubiquitin-protein ligase NEURL1B
2	9606.ENSP00000188312	0.654	ARP6 actin related protein 6 homolog
3	9606.ENSP00000395995	0.624	Coiled-coil domain-containing protein 141
4	9606.ENSP00000362330	0.596	Chromodomain-helicase-DNA-binding protein 6
5	9606.ENSP00000323913	0.575	Tripartite motif-containing protein 55
6	9606.ENSP00000347626	0.570	NudC domain containing 3
7	9606.ENSP00000427802	0.561	Nascent polypeptide-associated complex subunit alpha-2
8	9606.ENSP00000308597	0.557	Deleted in lung and esophageal cancer protein 1
9	9606.ENSP00000448035	0.553	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
10	9606.ENSP00000003302	0.541	Ubiquitin carboxyl-terminal hydrolase 28
11	9606.ENSP00000351933	0.534	Kelch-like protein 9
12	9606.ENSP00000457206	0.534	SPRY domain-containing SOCS box protein 3
13	9606.ENSP00000352282	0.515	Kelch domain containing 1
14	9606.ENSP00000321537	0.513	Lethal(2) giant larvae protein homolog 1
15	9606.ENSP00000468354	0.512	Ankyrin repeat domain-containing protein 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.973	regulation of biological process
GO:0050794	0.959	regulation of cellular process
GO:0009987	0.814	cellular process
GO:0008152	0.748	metabolic process
GO:0071704	0.738	organic substance metabolic process
GO:0006807	0.697	nitrogen compound metabolic process
GO:0044238	0.693	primary metabolic process
GO:1901564	0.652	organonitrogen compound metabolic process
GO:0043170	0.627	macromolecule metabolic process
GO:0019538	0.602	protein metabolic process
GO:0019222	0.450	regulation of metabolic process
GO:0032446	0.423	protein modification by small protein conjugation
GO:0060255	0.355	regulation of macromolecule metabolic process
GO:0048518	0.350	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005737	0.972	cytoplasm
GO:0043226	0.971	organelle
GO:0032991	0.964	protein-containing complex
GO:0043228	0.921	non-membrane-bounded organelle
GO:0043229	0.906	intracellular organelle
GO:0005829	0.905	cytosol
GO:0043232	0.883	intracellular non-membrane-bounded organelle
GO:0005634	0.871	nucleus
GO:0140535	0.656	intracellular protein-containing complex
GO:1902494	0.599	catalytic complex
GO:0031463	0.592	Cul3-RING ubiquitin ligase complex
GO:0005856	0.333	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]