StarFunc result for job id Q2WGJ9

User Input

>input (1857 residues)
MFGLKVKKKRNKAEKGLILANKAAKDSQGDTEALQEEPSHQEGPRGDLVHDDASIFPVPS
ASPKRRSKLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEG
TNSPFYNEYFVFDFIGPQVHLFDKIIKISVFHHKLIGSVLIGSFKVDLGTVYNQPGHQFC
NKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKTSDTEEPIEKNLLIPNGFPLER
PWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCA
DPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKISNEQDGDKGFLPTF
GPAWINLYGSPRNHSLMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALK
ELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFL
LFGAFFEATMIDRKIGDKPISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQ
GDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNML
EKMADFLEESIEEVRELIKISQEAPEEKMKTVLSDFISRSSAFISEAEKKPKMLNQTTLD
KKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVF
IWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPGKRPAGWSVQAKVDVY
LWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIA
ADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVV
ELYDSDAVGKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVP
PSGLQGLPPVEPPDITQIYPVPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQALIE
CGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTY
TINYLKQFLCKLREPLAPITQVDGTQPGHDISDSLTATESSGAHSSSQDPPADHIYVDVE
PPPTVVPDSAQAQPAILVDVPDSSPMLEPEHTPVAQEPPKDGKPKDPRKPSRRSTKRRKR
TIADESAENVIDWWSKYYASLKKAQKAKERNPKGKKGNTEAKPDEVVVDIEDGPKKKKDK
MLKKKPKDDGIPNLAILQIYDGDLESEFNNFEDWVKTFELFRGKSTEDDHGLDGDRVIGK
FKGSFCIYKSPQDSSSEDSGQLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPY
IVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGET
KIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFHPGKIQ
IGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPEVGCRLVPEHIETRPLYHKDK
PGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQK
SSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFS
LEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEET
KISIFQQKRVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPD
TSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIVVGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7Z0E5	0.604	0.674	0.000	1647	0.224	0.253	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
2	AFDB:E0CZ42	0.916	0.913	0.000	1862	0.883	0.881	E0CZ42.pdb.gz	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	AFDB:E7F4H1	0.592	0.534	0.000	2097	0.351	0.310	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
4	AFDB:F8W4A8	0.795	0.831	0.000	1773	0.487	0.510	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
5	AFDB:Q17388	0.569	0.524	0.000	2034	0.222	0.203	Q17388.pdb.gz	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
6	AFDB:Q5SPC5	0.787	0.736	0.000	1992	0.502	0.468	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
7	AFDB:Q9ERC5	0.777	0.727	0.000	1993	0.498	0.464	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
8	AFDB:Q9ESD7	0.580	0.522	0.000	2090	0.341	0.303	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
9	AFDB:Q9ESF1	0.779	0.727	0.000	1997	0.488	0.454	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
10	AFDB:Q9NZM1	0.565	0.517	0.000	2061	0.339	0.306	Q9NZM1.pdb.gz	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
11	PDB:5iz5B	0.063	0.145	1.238E-9	746	0.022	0.054	5iz5B.pdb.gz
12	PDB:6kxkD	0.058	0.179	3.022E-9	553	0.025	0.083	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5iz5A	0.069	0.142	3.430E-8	757	0.022	0.054	5iz5A.pdb.gz
14	PDB:5ixcA	0.065	0.153	3.192E-7	684	0.022	0.060	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5a50A	0.066	0.659	2.206E-6	165	0.020	0.224	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:1cjyA	0.059	0.165	3.806E-6	633	0.011	0.033	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:5a52A	0.062	0.661	5.945E-6	154	0.019	0.227	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5izrC	0.058	0.157	1.190E-5	659	0.020	0.056	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:3nsjA	0.064	0.190	3.541E-5	530	0.022	0.077	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:3pfqA	0.049	0.167	3.721E-5	523	0.022	0.076	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E0CZ42	0.0	3256	1862	0.880	0.878	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
2	F8W4A8	0.0	1777	1773	0.486	0.509	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
3	Q5SPC5	0.0	1095	1992	0.305	0.285	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
4	Q69ZN7	0.0	670	2048	0.209	0.190	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
5	Q9ERC5	0.0	1084	1993	0.297	0.276	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
6	Q9ESF1	0.0	1786	1997	0.497	0.462	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
7	Q9HC10	0.0	1788	1997	0.493	0.459	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
8	Q9NZM1	0.0	669	2061	0.212	0.191	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
9	F1QIS3	3.01e-146	503	2088	0.152	0.136	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
10	E7F4H1	3.11e-146	503	2097	0.152	0.135	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
11	F6IA09	8.03e-145	499	2088	0.151	0.135	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
12	O75923	6.59e-142	490	2080	0.142	0.126	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
13	D4A6X1	2.88e-141	488	2029	0.145	0.133	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
14	Q9ESD7	3.41e-141	488	2090	0.144	0.128	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
15	B7Z0E8	1.28e-104	352	648	0.110	0.315	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
16	B7Z0E7	2.28e-99	354	1351	0.110	0.151	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
17	B7Z0E6	8.86e-99	353	1439	0.110	0.142	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E5	4.75e-98	353	1647	0.106	0.119	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0F0	1.16e-93	331	1045	0.100	0.178	B7Z0F0_DROME Misfire, isoform B OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E9	1.44e-91	330	1398	0.100	0.133	B7Z0E9_DROME Misfire, isoform C OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	9.2e-68	236.4	C2 domain
2	PF08150 FerB	7.2e-27	105.1	FerB (NUC096) domain
3	PF08151 FerI	9.1e-16	69.0	FerI (NUC094) domain
4	PF16165 Ferlin_C	1.8e-34	130.4	Ferlin C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470560	0.651	Ribosomal RNA small subunit methyltransferase NEP1
2	9606.ENSP00000263277	0.622	EH domain-containing protein 2
3	9606.ENSP00000255224	0.575	Synaptotagmin-4
4	9606.ENSP00000261205	0.574	Synaptotagmin-1
5	9606.ENSP00000353739	0.555	protein-L-isoaspartate O-methyltransferase domain containing 1
6	9606.ENSP00000307854	0.545	protein-L-isoaspartate O-methyltransferase domain containing 2
7	9606.ENSP00000386137	0.542	Olfactory receptor 2A14
8	9606.ENSP00000353114	0.528	AHNAK nucleoprotein 2
9	9606.ENSP00000356236	0.526	Synaptotagmin-2
10	9606.ENSP00000357307	0.523	Synaptotagmin-11
11	9606.ENSP00000479153	0.515	EH domain-containing protein 1
12	9606.ENSP00000251527	0.507	Extended synaptotagmin-2
13	9606.ENSP00000329995	0.506	Protein FAM186A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.960	protein-containing complex binding
GO:0043167	0.885	ion binding
GO:0005509	0.760	calcium ion binding
GO:0008289	0.690	lipid binding
GO:0005543	0.457	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.886	response to stimulus
GO:0009987	0.686	cellular process
GO:0065007	0.570	biological regulation
GO:0009605	0.454	response to external stimulus
GO:0050789	0.427	regulation of biological process
GO:0009607	0.398	response to biotic stimulus
GO:0044419	0.387	biological process involved in interspecies interaction between organisms
GO:0050794	0.366	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043226	0.986	organelle
GO:0012505	0.983	endomembrane system
GO:0043227	0.983	membrane-bounded organelle
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0031982	0.717	vesicle
GO:0031090	0.627	organelle membrane
GO:0031410	0.551	cytoplasmic vesicle
GO:0012506	0.425	vesicle membrane
GO:0030659	0.417	cytoplasmic vesicle membrane
GO:0098588	0.381	bounding membrane of organelle
GO:0005829	0.379	cytosol
GO:0030133	0.357	transport vesicle
GO:0098590	0.326	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]