StarFunc result for job id Q2Y0W8

User Input

>input (1093 residues)
MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQS
HRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTEL
DEICMKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL
DMHANSIEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVRSFAE
VGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKVDLHFMKKIPTGAEA
SNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKGQQYHEIGRSM
ATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLA
SFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGP
VLVFEKILFKFCKDYALSYLSLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASL
ICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYYCRCTLPENPNNHTLQYWKDHNIVTA
EVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFTTFILSSTLKTFKTSRY
FPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGWIINPIGPNPW
WTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILK
FIPMPVLYGVFLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQL
TCLVLLWVIKASPAAIVFPMMVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAK
KKAKEEEEAEKMLEIGGDKFPLESRKLLSSPGKNISCRCDPSEINISDEMPKTTVWKALS
MNSGNAKEKSLFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2Y0W8	1.000	1.000	0.000	1093	1.000	1.000	Q2Y0W8.pdb.gz	S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens OX=9606 GN=SLC4A8 PE=1 SV=1
2	AFDB:Q5DTL9	0.818	0.800	0.000	1118	0.762	0.745	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
3	AFDB:Q9R1N3	0.771	0.696	0.000	1218	0.722	0.648	Q9R1N3.pdb.gz	S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc4a7 PE=1 SV=1
4	AFDB:Q8BTY2	0.457	0.481	3.483E-104	1034	0.655	0.692	Q8BTY2.pdb.gz	S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus OX=10090 GN=Slc4a7 PE=1 SV=2
5	AFDB:F1QHT2	0.749	0.757	6.513E-99	1082	0.505	0.510	F1QHT2.pdb.gz
6	AFDB:M9PB60	0.522	0.508	4.455E-98	1126	0.491	0.477	M9PB60.pdb.gz	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
7	AFDB:Q8IPI3	0.735	0.679	4.455E-98	1190	0.488	0.448	Q8IPI3.pdb.gz	Q8IPI3_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=2
8	AFDB:A0A2R8PYB9	0.521	0.512	6.370E-98	1114	0.507	0.497	A0A2R8PYB9.pdb.gz
9	AFDB:O88343	0.755	0.765	1.246E-97	1079	0.506	0.513	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
10	AFDB:M9PCT2	0.731	0.776	3.486E-95	1027	0.480	0.511	M9PCT2.pdb.gz	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
11	PDB:8cs9g	0.458	0.597	3.811E-59	832	0.293	0.385	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.517	0.638	3.410E-56	850	0.300	0.386	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.414	0.931	8.007E-36	477	0.268	0.614	6caaA.pdb.gz
14	PDB:4yzfA	0.419	0.952	1.310E-33	475	0.190	0.438	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.311	0.785	1.375E-13	399	0.100	0.273	5l25A.pdb.gz
16	PDB:7lguA	0.293	0.451	1.287E-8	680	0.051	0.082	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:7ch1A	0.267	0.426	3.939E-6	640	0.054	0.092	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:5i6cA	0.260	0.511	4.607E-5	480	0.056	0.127	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
19	PDB:3qe7A	0.239	0.537	3.151E-4	407	0.059	0.157	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
20	PDB:5j4nA	0.065	0.128	1.612E-2	437	0.066	0.165	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	653	1170	0.332	0.310	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	1056	1073	0.498	0.507	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A0A494BA31	756	952	0.390	0.447	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
4	A0A494BAI0	602	871	0.320	0.402	A0A494BAI0_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BAK5	692	821	0.342	0.456	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A0A494BBC3	698	918	0.372	0.443	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
7	A9NIM6	668	1232	0.349	0.309	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
8	B0S7B8	640	1228	0.343	0.305	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
9	B3WFV9	834	1215	0.415	0.374	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
10	E9PUP3	706	929	0.373	0.439	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
11	E9Q3M5	976	1116	0.456	0.446	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
12	G5EC65	958	1119	0.479	0.468	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
13	G5EDF4	952	1161	0.471	0.444	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
14	M9PB59	1034	1134	0.493	0.475	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PB60	1032	1126	0.492	0.478	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PC92	1033	1086	0.484	0.487	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PC95	1014	1046	0.472	0.493	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PCF0	1019	1067	0.470	0.482	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	M9PCT2	1029	1027	0.466	0.496	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
20	M9PF01	1023	1053	0.471	0.489	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	2e-106	367.2	Band 3 cytoplasmic domain
2	PF07931 CPT	6.7e+02	11.5	Chloramphenicol phosphotransferase-like protein
3	PF00955 HCO3_cotransp	1.1e-231	781.7	HCO3- transporter family
4	PF09299 Mu-transpos_C	1.4e+02	13.9	Mu transposase, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265715	0.894	Pendrin
2	9606.ENSP00000358814	0.735	S-adenosylhomocysteine hydrolase-like protein 1
3	9606.ENSP00000263980	0.712	Sodium/hydrogen exchanger 1
4	9606.ENSP00000358515	0.696	Solute carrier family 22 member 15
5	9606.ENSP00000262461	0.693	Solute carrier family 12 member 2
6	9606.ENSP00000285379	0.690	Carbonic anhydrase 2
7	9606.ENSP00000264938	0.671	Sodium/hydrogen exchanger 3
8	9606.ENSP00000378074	0.662	Sodium/nucleoside cotransporter 1
9	9606.ENSP00000005226	0.653	Harmonin
10	9606.ENSP00000384582	0.649	G-protein coupled receptor 98
11	9606.ENSP00000260570	0.648	Intraflagellar transport protein 172 homolog
12	9606.ENSP00000356436	0.647	Cytosolic phospholipase A2
13	9606.ENSP00000378920	0.621	Solute carrier family 26 member 6
14	9606.ENSP00000284885	0.607	Enteropeptidase
15	9606.ENSP00000402152	0.594	Solute carrier family 12 member 3
16	9606.ENSP00000233969	0.589	Sodium/hydrogen exchanger 2
17	9606.ENSP00000305941	0.588	Usherin
18	9606.ENSP00000003084	0.576	Cystic fibrosis transmembrane conductance regulator
19	9606.ENSP00000262352	0.576	Excitatory amino acid transporter 3
20	9606.ENSP00000387694	0.570	Solute carrier family 12 member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0015108	0.999	chloride transmembrane transporter activity
GO:0005452	0.999	solute:inorganic anion antiporter activity
GO:0140828	0.999	metal cation:monoatomic cation antiporter activity
GO:0005515	0.996	protein binding
GO:0140900	0.550	chloride:bicarbonate antiporter activity
GO:0042802	0.484	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.994	localization
GO:0065007	0.992	biological regulation
GO:0006810	0.979	transport
GO:0006885	0.975	regulation of pH
GO:0009987	0.966	cellular process
GO:0019725	0.886	cellular homeostasis
GO:0030003	0.867	intracellular monoatomic cation homeostasis
GO:0030641	0.859	regulation of cellular pH
GO:0051453	0.834	regulation of intracellular pH
GO:0006811	0.809	monoatomic ion transport
GO:0071702	0.533	organic substance transport
GO:0050789	0.372	regulation of biological process
GO:0098660	0.335	inorganic ion transmembrane transport
GO:0006820	0.326	monoatomic anion transport
GO:0015698	0.318	inorganic anion transport
GO:0050794	0.300	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.819	plasma membrane region
GO:0043226	0.727	organelle
GO:0043227	0.707	membrane-bounded organelle
GO:0042995	0.671	cell projection
GO:0045178	0.665	basal part of cell
GO:0009925	0.633	basal plasma membrane
GO:0120025	0.614	plasma membrane bounded cell projection
GO:0031982	0.591	vesicle
GO:0016323	0.561	basolateral plasma membrane
GO:0005622	0.464	intracellular anatomical structure
GO:0005737	0.454	cytoplasm
GO:0045177	0.332	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29823	0.999	chloride(in) = chloride(out)

[back to server]