StarFunc result for job id Q30154

User Input

>input (266 residues)
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q30154	1.000	1.000	2.511E-50	266	1.000	1.000	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
2	AFDB:P13762	0.852	0.852	6.865E-45	266	0.861	0.861	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
3	AFDB:A0A0G4PYZ0	0.756	0.756	4.537E-43	266	0.887	0.887	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
4	AFDB:P79483	0.818	0.818	1.769E-42	266	0.868	0.868	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
5	AFDB:P04230	0.802	0.807	1.031E-39	264	0.718	0.723	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
6	AFDB:P18211	0.707	0.711	4.021E-39	264	0.692	0.697	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
7	AFDB:P05538	0.856	0.850	1.117E-34	268	0.643	0.638	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
8	AFDB:P01920	0.785	0.799	3.505E-34	261	0.617	0.628	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
9	AFDB:P29826	0.775	0.783	4.126E-34	263	0.605	0.612	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
10	AFDB:P01921	0.736	0.738	2.773E-33	265	0.605	0.608	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
11	PDB:6cplA	0.393	0.569	2.477E-14	180	0.154	0.228	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:3es6A	0.502	0.485	9.656E-14	277	0.165	0.159	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:5j6hA	0.473	0.461	2.113E-11	275	0.169	0.164	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6fgbA	0.488	0.489	2.113E-11	265	0.180	0.181	6fgbA.pdb.gz
15	PDB:6d7gA	0.402	0.305	4.061E-11	386	0.188	0.130	6d7gA.pdb.gz
16	PDB:6mp0A	0.435	0.329	4.528E-11	388	0.188	0.129	6mp0A.pdb.gz
17	PDB:6e1iA	0.421	0.316	7.390E-11	389	0.188	0.129	6e1iA.pdb.gz
18	PDB:3s6cA	0.493	0.371	1.274E-10	372	0.165	0.118	3s6cA.pdb.gz
19	PDB:1cd1A	0.516	0.505	1.123E-9	273	0.147	0.143	1cd1A.pdb.gz
20	PDB:3ov6A	0.508	0.379	2.044E-9	376	0.158	0.112	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q30154	0.0	555	266	1.000	1.000	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
2	P01911	3.78e-167	464	266	0.887	0.887	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
3	A0A0G4PYZ0	1.16e-166	463	266	0.887	0.887	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
4	P13762	8.21e-162	451	266	0.861	0.861	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
5	P79483	8.49e-162	451	266	0.868	0.868	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
6	P18468	1.13e-144	407	264	0.722	0.727	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
7	P18469	7.72e-138	390	264	0.733	0.739	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
8	P04230	5.56e-134	380	264	0.718	0.723	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
9	P18211	1.76e-127	364	264	0.688	0.693	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
10	P04231	5.45e-127	362	232	0.680	0.780	HB23_MOUSE H-2 class II histocompatibility antigen, E-S beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
11	P06342	3.21e-115	333	265	0.620	0.623	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
12	P01921	3.23e-114	330	265	0.613	0.615	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
13	P14483	2.26e-113	328	265	0.613	0.615	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
14	P06345	3.44e-112	325	263	0.620	0.627	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
15	P06346	9.28e-111	321	252	0.605	0.639	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
16	P05538	9.61e-111	322	268	0.643	0.638	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
17	P01920	4.85e-110	320	261	0.617	0.628	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
18	P04440	6.78e-110	319	258	0.579	0.597	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
19	A0A1C3PI11	8.63e-110	319	258	0.571	0.589	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
20	P29826	5.00e-109	317	263	0.605	0.612	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.9e-22	90.7	Immunoglobulin C1-set domain
2	PF00047 ig	11	17.6	Immunoglobulin domain
3	PF00969 MHC_II_beta	1.1e-32	123.3	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364114

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378786	0.997	HLA class II histocompatibility antigen, DR alpha chain
2	9606.ENSP00000009530	0.945	HLA class II histocompatibility antigen gamma chain
3	9606.ENSP00000353099	0.944	HLA class II histocompatibility antigen, DRB1-15 beta chain
4	9606.ENSP00000357981	0.927	Cathepsin S
5	9606.ENSP00000363976	0.926	HLA class II histocompatibility antigen, DM alpha chain
6	9606.ENSP00000411355	0.926	Receptor-type tyrosine-protein phosphatase C
7	9606.ENSP00000227266	0.920	Dipeptidyl peptidase 1
8	9606.ENSP00000352833	0.919	Tyrosine-protein phosphatase non-receptor type 22
9	9606.ENSP00000370989	0.913	Programmed cell death 1 ligand 1
10	9606.ENSP00000335062	0.910	Programmed cell death protein 1
11	9606.ENSP00000345672	0.910	Cathepsin B
12	9606.ENSP00000380855	0.907	Programmed cell death 1 ligand 2
13	9606.ENSP00000220166	0.906	Pro-cathepsin H
14	9606.ENSP00000376911	0.906	Legumain
15	9606.ENSP00000345344	0.904	Cathepsin L1
16	9606.ENSP00000391592	0.904	Tyrosine-protein phosphatase non-receptor type 6
17	9606.ENSP00000445052	0.904	Cathepsin L2
18	9606.ENSP00000236671	0.903	Cathepsin D
19	9606.ENSP00000350911	0.903	Cathepsin E
20	9606.ENSP00000220003	0.902	Tyrosine-protein kinase CSK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.425	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002504	0.997	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0019884	0.996	antigen processing and presentation of exogenous antigen
GO:0048002	0.995	antigen processing and presentation of peptide antigen
GO:0050896	0.991	response to stimulus
GO:0002495	0.960	antigen processing and presentation of peptide antigen via MHC class II
GO:0002478	0.953	antigen processing and presentation of exogenous peptide antigen
GO:0019886	0.933	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0009987	0.918	cellular process
GO:0050789	0.908	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0006955	0.747	immune response
GO:0048518	0.737	positive regulation of biological process
GO:0048522	0.584	positive regulation of cellular process
GO:0002682	0.508	regulation of immune system process
GO:0051716	0.497	cellular response to stimulus
GO:0048583	0.475	regulation of response to stimulus
GO:0007165	0.461	signal transduction
GO:0002684	0.458	positive regulation of immune system process
GO:0048584	0.453	positive regulation of response to stimulus
GO:0051239	0.441	regulation of multicellular organismal process
GO:0002694	0.420	regulation of leukocyte activation
GO:0019222	0.414	regulation of metabolic process
GO:0060255	0.396	regulation of macromolecule metabolic process
GO:0050778	0.395	positive regulation of immune response
GO:0048519	0.334	negative regulation of biological process
GO:0051240	0.311	positive regulation of multicellular organismal process
GO:0010468	0.309	regulation of gene expression
GO:0051249	0.308	regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	1.000	bounding membrane of organelle
GO:0005794	1.000	Golgi apparatus
GO:0031984	0.999	organelle subcompartment
GO:0030135	0.999	coated vesicle
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0098797	0.995	plasma membrane protein complex
GO:0030139	0.995	endocytic vesicle
GO:0098552	0.994	side of membrane
GO:0030134	0.994	COPII-coated ER to Golgi transport vesicle
GO:0005789	0.992	endoplasmic reticulum membrane
GO:0030666	0.992	endocytic vesicle membrane
GO:0030662	0.991	coated vesicle membrane
GO:0000139	0.987	Golgi membrane
GO:0005765	0.986	lysosomal membrane
GO:0030133	0.985	transport vesicle
GO:0012507	0.975	ER to Golgi transport vesicle membrane
GO:0005768	0.970	endosome
GO:0005802	0.969	trans-Golgi network
GO:0005576	0.958	extracellular region
GO:0032588	0.957	trans-Golgi network membrane
GO:0030665	0.957	clathrin-coated vesicle membrane
GO:0045334	0.956	clathrin-coated endocytic vesicle
GO:0010008	0.951	endosome membrane
GO:0042611	0.944	MHC protein complex
GO:0098576	0.943	lumenal side of membrane
GO:0030669	0.935	clathrin-coated endocytic vesicle membrane
GO:0098553	0.928	lumenal side of endoplasmic reticulum membrane
GO:0005770	0.919	late endosome
GO:0042613	0.893	MHC class II protein complex
GO:0070062	0.892	extracellular exosome
GO:0031902	0.811	late endosome membrane
GO:0009986	0.601	cell surface
GO:0005769	0.366	early endosome
GO:0009897	0.319	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]