StarFunc result for job id Q30201

User Input

>input (348 residues)
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q30201	1.000	1.000	2.103E-67	348	1.000	1.000	Q30201.pdb.gz	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
2	AFDB:P70387	0.810	0.786	1.493E-49	359	0.690	0.669	P70387.pdb.gz	HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus OX=10090 GN=Hfe PE=1 SV=2
3	AFDB:O35799	0.651	0.634	2.593E-49	360	0.704	0.681	O35799.pdb.gz	HFE_RAT Hereditary hemochromatosis protein homolog OS=Rattus norvegicus OX=10116 GN=Hfe PE=2 SV=1
4	AFDB:A0ZXM3	0.755	0.737	4.260E-34	357	0.302	0.294	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
5	AFDB:U3PTD3	0.758	0.766	1.030E-33	344	0.302	0.305	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:Q95460	0.683	0.696	2.142E-32	341	0.325	0.331	Q95460.pdb.gz	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
7	AFDB:Q4KN81	0.755	0.732	2.822E-32	360	0.365	0.353	Q4KN81.pdb.gz	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
8	AFDB:A0A583ZBW8	0.716	0.684	3.519E-32	366	0.351	0.333	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
9	AFDB:P01889	0.708	0.683	4.388E-32	362	0.345	0.331	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
10	AFDB:Q8HWB0	0.718	0.732	4.637E-32	341	0.310	0.317	Q8HWB0.pdb.gz	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
11	PDB:5j6hA	0.691	0.859	3.323E-28	275	0.307	0.389	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
12	PDB:3es6A	0.679	0.836	2.705E-27	277	0.284	0.357	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:6d7gA	0.653	0.595	1.017E-26	386	0.313	0.282	6d7gA.pdb.gz
14	PDB:6e1iA	0.664	0.600	1.017E-26	389	0.305	0.272	6e1iA.pdb.gz
15	PDB:6mp0A	0.668	0.605	1.359E-25	388	0.282	0.253	6mp0A.pdb.gz
16	PDB:2qriA	0.708	0.624	1.437E-25	398	0.316	0.276	2qriA.pdb.gz
17	PDB:6fgbA	0.701	0.907	2.000E-25	265	0.213	0.279	6fgbA.pdb.gz
18	PDB:3nwmA	0.672	0.613	2.943E-25	384	0.296	0.268	3nwmA.pdb.gz
19	PDB:1cd1A	0.665	0.829	2.724E-19	273	0.164	0.209	1cd1A.pdb.gz
20	PDB:3ov6A	0.664	0.618	2.879E-19	376	0.178	0.165	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W7W8	0.0	696	337	0.963	0.994	F8W7W8_HUMAN Homeostatic iron regulator OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
2	Q30201	0.0	723	348	1.000	1.000	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
3	Q6B0J5	0.0	687	345	0.960	0.968	Q6B0J5_HUMAN HFE protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
4	P70387	1.70e-174	490	359	0.661	0.641	HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus OX=10090 GN=Hfe PE=1 SV=2
5	O35799	1.59e-170	480	360	0.661	0.639	HFE_RAT Hereditary hemochromatosis protein homolog OS=Rattus norvegicus OX=10116 GN=Hfe PE=2 SV=1
6	Q95460	1.60e-68	220	341	0.351	0.358	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
7	P04439	6.00e-64	209	365	0.365	0.348	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
8	Q4KN81	6.84e-64	208	360	0.356	0.344	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
9	Q5SUL5	9.84e-63	206	365	0.356	0.340	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
10	Q8HWB0	4.59e-62	203	341	0.322	0.328	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
11	A0A0G2K4S5	1.90e-61	202	356	0.351	0.343	A0A0G2K4S5_RAT RT1 class Ia, locus A2 OS=Rattus norvegicus OX=10116 GN=RT1-CE1 PE=3 SV=2
12	P01900	2.72e-61	202	365	0.342	0.326	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
13	Q6MGB8	2.27e-60	199	366	0.371	0.352	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
14	P01901	9.87e-60	198	369	0.348	0.328	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
15	Q6SY93	2.92e-59	196	340	0.336	0.344	Q6SY93_RAT MHC class Ib antigen (Fragment) OS=Rattus norvegicus OX=10116 GN=RT1-L3 PE=3 SV=1
16	A0ZXM3	5.14e-59	196	357	0.313	0.305	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
17	P14426	1.28e-58	195	362	0.342	0.329	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
18	P04223	1.49e-58	195	369	0.345	0.325	HA1K_MOUSE H-2 class I histocompatibility antigen, K-K alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
19	Q63678	2.65e-58	192	296	0.290	0.341	ZA2G_RAT Zinc-alpha-2-glycoprotein OS=Rattus norvegicus OX=10116 GN=Azgp1 PE=2 SV=1
20	P01893	3.97e-58	194	362	0.336	0.323	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3e-10	51.6	Immunoglobulin C1-set domain
2	PF00047 ig	2.3e+02	13.4	Immunoglobulin domain
3	PF13895 Ig_2	8	18.2	Immunoglobulin domain
4	PF13927 Ig_3	1.5	20.8	Immunoglobulin domain
5	PF17870 Insulin_TMD	19	16.7	Insulin receptor trans-membrane segment
6	PF00129 MHC_I	5.1e-40	148.4	Class I Histocompatibility antigen, domains alpha 1 and 2
7	PF16497 MHC_I_3	6.2e-06	37.4	MHC-I family domain
8	PF06024 Orf78	1.7e+02	13.9	Orf78 (ac78)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353224	0.999	Transferrin receptor protein 1
2	9606.ENSP00000452780	0.999	Beta-2-microglobulin
3	9606.ENSP00000420525	0.997	Transferrin receptor protein 2
4	9606.ENSP00000337014	0.996	Hemojuvelin
5	9606.ENSP00000471894	0.915	Hepcidin
6	9606.ENSP00000261024	0.860	Solute carrier family 40 member 1
7	9606.ENSP00000371211	0.859	Transmembrane protease serine 6
8	9606.ENSP00000399168	0.850	HLA class I histocompatibility antigen, B-7 alpha chain
9	9606.ENSP00000361107	0.804	Bone morphogenetic protein receptor type-1A
10	9606.ENSP00000385834	0.799	Serotransferrin
11	9606.ENSP00000378364	0.768	Natural resistance-associated macrophage protein 2
12	9606.ENSP00000476136	0.767	Histone H2B type 1-J
13	9606.ENSP00000365817	0.762	HLA class I histocompatibility antigen, alpha chain E
14	9606.ENSP00000328484	0.759	Histone H2A type 1-J
15	9606.ENSP00000264108	0.747	Histone acetyltransferase type B catalytic subunit
16	9606.ENSP00000378295	0.722	Inner centromere protein
17	9606.ENSP00000319141	0.720	Cytochrome b reductase 1
18	9606.ENSP00000297792	0.719	Lysine-specific histone demethylase 1B
19	9606.ENSP00000430620	0.716	Hephaestin
20	9606.ENSP00000362146	0.715	Borealin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.968	signaling receptor binding
GO:0030881	0.500	beta-2-microglobulin binding
GO:0042277	0.392	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042592	0.983	homeostatic process
GO:0009987	0.983	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.974	response to stimulus
GO:0055072	0.965	iron ion homeostasis
GO:0048523	0.954	negative regulation of cellular process
GO:0048518	0.878	positive regulation of biological process
GO:0032501	0.858	multicellular organismal process
GO:0019222	0.802	regulation of metabolic process
GO:0060255	0.793	regulation of macromolecule metabolic process
GO:0048583	0.788	regulation of response to stimulus
GO:0006879	0.756	intracellular iron ion homeostasis
GO:0080090	0.740	regulation of primary metabolic process
GO:0051171	0.738	regulation of nitrogen compound metabolic process
GO:0048522	0.662	positive regulation of cellular process
GO:0051716	0.613	cellular response to stimulus
GO:0031323	0.613	regulation of cellular metabolic process
GO:0051172	0.602	negative regulation of nitrogen compound metabolic process
GO:0051246	0.568	regulation of protein metabolic process
GO:0010605	0.557	negative regulation of macromolecule metabolic process
GO:1903050	0.547	regulation of proteolysis involved in protein catabolic process
GO:0009894	0.531	regulation of catabolic process
GO:0048871	0.488	multicellular organismal-level homeostasis
GO:0008152	0.473	metabolic process
GO:0010468	0.466	regulation of gene expression
GO:0002682	0.434	regulation of immune system process
GO:0045861	0.432	negative regulation of proteolysis
GO:0044237	0.404	cellular metabolic process
GO:0002376	0.383	immune system process
GO:0002706	0.354	regulation of lymphocyte mediated immunity
GO:0048584	0.347	positive regulation of response to stimulus
GO:0051239	0.341	regulation of multicellular organismal process
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0071840	0.326	cellular component organization or biogenesis
GO:0006950	0.323	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005654	0.996	nucleoplasm
GO:0005737	0.819	cytoplasm
GO:0032991	0.614	protein-containing complex
GO:0012505	0.562	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]