StarFunc result for job id Q30KQ5

User Input

>input (88 residues)
MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCG
EKHICCVPKEKDKLSHIHDQKETSELYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q30KQ5	1.000	1.000	2.981E-16	88	1.000	1.000	Q30KQ5.pdb.gz	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
2	AFDB:Q95LI0	0.418	0.304	1.045E-5	123	0.330	0.236	Q95LI0.pdb.gz	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
3	AFDB:Q5J5C9	0.450	0.508	3.766E-5	76	0.295	0.342	Q5J5C9.pdb.gz	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
4	AFDB:Q96PH6	0.427	0.319	4.610E-5	123	0.284	0.203	Q96PH6.pdb.gz	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
5	AFDB:Q8N690	0.400	0.418	7.392E-5	84	0.239	0.250	Q8N690.pdb.gz	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
6	AFDB:Q8BVC1	0.522	0.288	9.050E-5	179	0.216	0.106	Q8BVC1.pdb.gz	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
7	AFDB:Q9BYW3	0.489	0.402	1.661E-4	111	0.227	0.180	Q9BYW3.pdb.gz	DB126_HUMAN Beta-defensin 126 OS=Homo sapiens OX=9606 GN=DEFB126 PE=1 SV=2
8	AFDB:Q8NES8	0.410	0.499	6.399E-4	71	0.216	0.268	Q8NES8.pdb.gz	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
9	AFDB:Q8NET1	0.326	0.388	1.344E-3	73	0.216	0.260	Q8NET1.pdb.gz	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
10	AFDB:Q8WTQ1	0.378	0.456	2.014E-3	72	0.239	0.292	Q8WTQ1.pdb.gz	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
11	PDB:2lwlA	0.256	0.477	7.255E-1	45	0.080	0.156	2lwlA.pdb.gz
12	PDB:1e4rA	0.273	0.555	1.016	35	0.102	0.257	1e4rA.pdb.gz
13	PDB:6cs9A	0.299	0.592	1.331	41	0.068	0.146	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
14	PDB:1kj6A	0.289	0.523	1.524	45	0.125	0.244	1kj6A.pdb.gz
15	PDB:5xbsA	0.184	0.090	3.422	246	0.136	0.049	5xbsA.pdb.gz
16	PDB:4hmyS	0.173	0.109	4.190	145	0.091	0.055	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
17	PDB:7u06G	0.223	0.129	4.190	158	0.114	0.063	7u06G.pdb.gz
18	PDB:6khdB	0.210	0.062	5.488	332	0.125	0.033	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
19	PDB:6ta5D	0.154	0.055	5.488	345	0.159	0.041	6ta5D.pdb.gz
20	PDB:1bnbA	0.290	0.587	5.870	38	0.102	0.237	1bnbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q30KQ5	1.30e-60	181	88	1.000	1.000	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
2	Q95LI0	1.85e-04	39.3	123	0.193	0.138	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
3	Q9BYW3	8.40e-04	37.4	111	0.216	0.171	DB126_HUMAN Beta-defensin 126 OS=Homo sapiens OX=9606 GN=DEFB126 PE=1 SV=2
4	Q8BVC1	0.001	37.7	179	0.216	0.106	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
5	Q96PH6	0.003	36.2	123	0.159	0.114	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
6	Q9H1M3	0.008	35.4	183	0.182	0.087	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
7	Q8WTQ1	0.019	33.1	72	0.182	0.222	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
8	Q8NET1	0.29	30.0	73	0.170	0.205	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
9	Q5J5C9	0.47	29.6	76	0.250	0.289	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
10	Q9QW30	1.5	29.3	2471	0.205	0.007	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
11	Q8K4N3	1.8	28.1	78	0.239	0.269	DFB12_MOUSE Beta-defensin 12 OS=Mus musculus OX=10090 GN=Defb12 PE=2 SV=2
12	Q8NG11	2.0	28.9	270	0.148	0.048	TSN14_HUMAN Tetraspanin-14 OS=Homo sapiens OX=9606 GN=TSPAN14 PE=1 SV=1
13	Q8QZY6	2.0	28.9	270	0.148	0.048	TSN14_MOUSE Tetraspanin-14 OS=Mus musculus OX=10090 GN=Tspan14 PE=1 SV=1
14	G1K218	2.8	28.5	1367	0.159	0.010	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
15	Q7Z7B8	3.8	27.3	93	0.170	0.161	DB128_HUMAN Beta-defensin 128 OS=Homo sapiens OX=9606 GN=DEFB128 PE=1 SV=1
16	Q10201	4.2	28.1	949	0.205	0.019	YBX7_SCHPO Uncharacterized protein C17D1.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC17D1.07c PE=4 SV=2
17	Q10495	4.2	28.1	977	0.250	0.023	YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26F1.08c PE=4 SV=1
18	P38232	6.7	27.3	338	0.136	0.036	REG2_YEAST Protein REG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REG2 PE=1 SV=1
19	F4I893	7.3	27.3	2696	0.205	0.007	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13841 Defensin_beta_2	0.55	22.0	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360190	0.964	Beta-defensin 110
2	9606.ENSP00000383396	0.964	Beta-defensin 116
3	9606.ENSP00000326309	0.962	Beta-defensin 124
4	9606.ENSP00000371825	0.955	Beta-defensin 127
5	9606.ENSP00000297439	0.950	Beta-defensin 1
6	9606.ENSP00000312702	0.948	Beta-defensin 114
7	9606.ENSP00000335382	0.943	Beta-defensin 128
8	9606.ENSP00000335538	0.931	Beta-defensin 131A
9	9606.ENSP00000381703	0.909	Beta-defensin 113
10	9606.ENSP00000417128	0.906	Beta-defensin 121
11	9606.ENSP00000371643	0.905	Beta-defensin 135
12	9606.ENSP00000485031	0.905	Beta-defensin 133
13	9606.ENSP00000365492	0.904	Defensin beta 119
14	9606.ENSP00000253381	0.903	Beta-defensin 118
15	9606.ENSP00000319126	0.903	Beta-defensin 112
16	9606.ENSP00000371644	0.903	Beta-defensin 136
17	9606.ENSP00000246105	0.902	Beta-defensin 129
18	9606.ENSP00000365486	0.902	Beta-defensin 123
19	9606.ENSP00000371835	0.902	Beta-defensin 126
20	9606.ENSP00000371847	0.902	Beta-defensin 125

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050829	0.995	defense response to Gram-negative bacterium
GO:0002376	0.982	immune system process
GO:0006955	0.951	immune response
GO:0009987	0.889	cellular process
GO:0050789	0.575	regulation of biological process
GO:0006959	0.532	humoral immune response
GO:0019730	0.518	antimicrobial humoral response
GO:0045087	0.503	innate immune response
GO:0061844	0.462	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050830	0.434	defense response to Gram-positive bacterium
GO:0031640	0.370	killing of cells of another organism
GO:0050794	0.356	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.974	extracellular space
GO:0005622	0.946	intracellular anatomical structure
GO:0005737	0.845	cytoplasm
GO:0070013	0.789	intracellular organelle lumen
GO:0043227	0.678	membrane-bounded organelle
GO:0043231	0.661	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]