StarFunc result for job id Q30KQ6

User Input

>input (69 residues)
MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTE
KLYEEDDMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q30KQ6	1.000	1.000	3.879E-13	69	1.000	1.000	Q30KQ6.pdb.gz	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
2	AFDB:Q8N104	0.515	0.537	3.485E-3	65	0.261	0.277	Q8N104.pdb.gz	D106A_HUMAN Beta-defensin 106 OS=Homo sapiens OX=9606 GN=DEFB106A PE=1 SV=1
3	AFDB:Q7TNV9	0.512	0.526	3.988E-3	67	0.333	0.343	Q7TNV9.pdb.gz	DFB14_MOUSE Beta-defensin 14 OS=Mus musculus OX=10090 GN=Defb14 PE=3 SV=1
4	AFDB:Q9WTL0	0.505	0.550	7.825E-3	63	0.304	0.333	Q9WTL0.pdb.gz	DEFB3_MOUSE Beta-defensin 3 OS=Mus musculus OX=10090 GN=Defb3 PE=2 SV=1
5	AFDB:Q8K4N2	0.523	0.512	9.578E-3	71	0.261	0.254	Q8K4N2.pdb.gz	SG11A_MOUSE Sperm-associated antigen 11A OS=Mus musculus OX=10090 GN=Spag11a PE=3 SV=2
6	AFDB:Q91VD6	0.495	0.539	9.578E-3	63	0.275	0.302	Q91VD6.pdb.gz	DEFB6_MOUSE Beta-defensin 6 OS=Mus musculus OX=10090 GN=Defb6 PE=2 SV=1
7	AFDB:P81534	0.521	0.535	1.096E-2	67	0.333	0.343	P81534.pdb.gz	D103A_HUMAN Beta-defensin 103 OS=Homo sapiens OX=9606 GN=DEFB103A PE=1 SV=2
8	AFDB:Q6IV18	0.508	0.401	1.254E-2	89	0.217	0.169	Q6IV18.pdb.gz	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
9	AFDB:P82019	0.494	0.537	1.342E-2	63	0.261	0.286	P82019.pdb.gz	DEFB4_MOUSE Beta-defensin 4 OS=Mus musculus OX=10090 GN=Defb4 PE=1 SV=1
10	AFDB:Q8IZN7	0.644	0.637	1.342E-2	70	0.246	0.243	Q8IZN7.pdb.gz	D107A_HUMAN Beta-defensin 107 OS=Homo sapiens OX=9606 GN=DEFB107A PE=2 SV=3
11	PDB:2lwlA	0.424	0.622	4.920E-2	45	0.159	0.244	2lwlA.pdb.gz
12	PDB:6cs9A	0.464	0.733	6.892E-2	41	0.174	0.293	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
13	PDB:1kj6A	0.403	0.575	1.447E-1	45	0.217	0.333	1kj6A.pdb.gz
14	PDB:1e4rA	0.347	0.576	5.570E-1	35	0.116	0.229	1e4rA.pdb.gz
15	PDB:1bnbA	0.320	0.488	2.005	38	0.130	0.237	1bnbA.pdb.gz
16	PDB:1xsdA	0.196	0.123	4.816	125	0.058	0.032	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
17	PDB:3b4vD	0.214	0.085	5.151	213	0.058	0.019	3b4vD.pdb.gz
18	PDB:7wfdAC	0.240	0.213	5.511	80	0.072	0.062	7wfdAC.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
19	PDB:7odrO	0.190	0.102	5.895	154	0.116	0.052	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
20	PDB:3ay0B	0.191	0.049	6.746	314	0.058	0.013	3ay0B.pdb.gz	Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q30KQ6	1.15e-45	141	69	1.000	1.000	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
2	P59861	0.004	34.3	70	0.261	0.257	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
3	Q9WTL0	0.040	31.6	63	0.304	0.333	DEFB3_MOUSE Beta-defensin 3 OS=Mus musculus OX=10090 GN=Defb3 PE=2 SV=1
4	Q30KQ8	0.51	29.3	113	0.232	0.142	DB112_HUMAN Beta-defensin 112 OS=Homo sapiens OX=9606 GN=DEFB112 PE=1 SV=1
5	Q9BV20	1.3	28.5	369	0.232	0.043	MTNA_HUMAN Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1 PE=1 SV=1
6	Q8K4N3	1.4	27.7	78	0.275	0.244	DFB12_MOUSE Beta-defensin 12 OS=Mus musculus OX=10090 GN=Defb12 PE=2 SV=2
7	Q581R6	1.7	28.5	561	0.217	0.027	Q581R6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1090 PE=4 SV=1
8	Q9VIK6	2.4	28.1	790	0.246	0.022	Q9VIK6_DROME Centrocortin, isoform A OS=Drosophila melanogaster OX=7227 GN=Cen PE=1 SV=1
9	Q76KF0	2.5	28.1	1073	0.203	0.013	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
10	Q8NFY4	2.5	28.1	1073	0.203	0.013	SEM6D_HUMAN Semaphorin-6D OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
11	Q98UI9	2.7	27.7	2108	0.159	0.005	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
12	Q9SIN2	3.7	27.3	367	0.188	0.035	TBL39_ARATH Protein trichome birefringence-like 39 OS=Arabidopsis thaliana OX=3702 GN=TBL39 PE=2 SV=1
13	Q10MX4	4.4	27.3	442	0.261	0.041	XOAT8_ORYSJ Probable xylan O-acetyltransferase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT8 PE=1 SV=1
14	P81534	4.8	26.2	67	0.333	0.343	D103A_HUMAN Beta-defensin 103 OS=Homo sapiens OX=9606 GN=DEFB103A PE=1 SV=2
15	Q9H2E6	5.6	26.9	1030	0.203	0.014	SEM6A_HUMAN Semaphorin-6A OS=Homo sapiens OX=9606 GN=SEMA6A PE=1 SV=3
16	O35464	5.8	26.9	1031	0.203	0.014	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
17	Q8MZG9	6.0	26.9	325	0.232	0.049	Q8MZG9_DROME LP06328p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2070 PE=2 SV=1
18	Q14767	7.8	26.6	1821	0.304	0.012	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
19	D4AAN8	8.8	26.6	1087	0.232	0.015	D4AAN8_RAT DNA helicase B OS=Rattus norvegicus OX=10116 GN=Helb PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00711 Defensin_beta	4.9	18.6	Beta defensin
2	PF13841 Defensin_beta_2	0.0011	30.7	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253381	0.977	Beta-defensin 118
2	9606.ENSP00000371835	0.975	Beta-defensin 126
3	9606.ENSP00000435010	0.971	Beta-defensin 134
4	9606.ENSP00000335382	0.964	Beta-defensin 128
5	9606.ENSP00000371825	0.962	Beta-defensin 127
6	9606.ENSP00000383396	0.962	Beta-defensin 116
7	9606.ENSP00000371847	0.957	Beta-defensin 125
8	9606.ENSP00000297439	0.953	Beta-defensin 1
9	9606.ENSP00000326309	0.953	Beta-defensin 124
10	9606.ENSP00000360190	0.952	Beta-defensin 110
11	9606.ENSP00000333234	0.948	Beta-defensin 108B
12	9606.ENSP00000383398	0.948	Beta-defensin 115
13	9606.ENSP00000365492	0.947	Defensin beta 119
14	9606.ENSP00000246105	0.917	Beta-defensin 129
15	9606.ENSP00000381703	0.917	Beta-defensin 113
16	9606.ENSP00000329890	0.915	Defensin-5
17	9606.ENSP00000417128	0.914	Beta-defensin 121
18	9606.ENSP00000319126	0.911	Beta-defensin 112
19	9606.ENSP00000297435	0.910	Neutrophil defensin 4
20	9606.ENSP00000365486	0.907	Beta-defensin 123

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001530	1.000	lipopolysaccharide binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0002376	0.992	immune system process
GO:0009617	0.992	response to bacterium
GO:0098542	0.988	defense response to other organism
GO:0032101	0.982	regulation of response to external stimulus
GO:0006955	0.980	immune response
GO:0050829	0.978	defense response to Gram-negative bacterium
GO:0050830	0.973	defense response to Gram-positive bacterium
GO:0045087	0.956	innate immune response
GO:0019222	0.954	regulation of metabolic process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0050794	0.888	regulation of cellular process
GO:0001817	0.793	regulation of cytokine production
GO:0009987	0.764	cellular process
GO:0048518	0.718	positive regulation of biological process
GO:0048519	0.678	negative regulation of biological process
GO:0050832	0.555	defense response to fungus
GO:0065009	0.496	regulation of molecular function
GO:0032102	0.483	negative regulation of response to external stimulus
GO:0032103	0.467	positive regulation of response to external stimulus
GO:0002831	0.435	regulation of response to biotic stimulus
GO:0019730	0.411	antimicrobial humoral response
GO:0031347	0.389	regulation of defense response
GO:0061844	0.374	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0051246	0.353	regulation of protein metabolic process
GO:0009892	0.351	negative regulation of metabolic process
GO:0010605	0.341	negative regulation of macromolecule metabolic process
GO:0009968	0.330	negative regulation of signal transduction
GO:0061760	0.314	antifungal innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.971	extracellular space
GO:0043231	0.872	intracellular membrane-bounded organelle
GO:0070013	0.433	intracellular organelle lumen
GO:0012505	0.426	endomembrane system
GO:0005737	0.352	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]