StarFunc result for job id Q32MH5

User Input

>input (1076 residues)
MKPDRDTLDEYFEYDAEEFLVSLALLITEGRTPECSVKGRTESFHCPPAQSCYPVTTKHE
CSDKLAQCRQARRTRSEVTLLWKNNLPIMVEMMLLPDCCYSDDGPTTEGIDLNDPAIKQD
ALLLERWILEPVPRQNGDRFIEEKTLLLAVRSFVFFSQLSAWLSVSHGAIPRNILYRISA
ADVDLQWNFSQTPIEHVFPVPNVSHNVALKVSVQSLPRQSNYPVLTCSIHTNIGLYEKRI
QQHKLKTHQHHNPNEAEQCGTNSSQRLCSKQTWTMAPESVLHAKSGPSPEYTAAVKNIKL
YPGTGSKSDHGTSQANILGFSGIGDIKSQETSVRTLKSFSMVDSSISNRQSFWQSAGETN
PLIGSLIQERQEIIARIAQHLIHCDPSTSHVSGRPFNTQESSSLHSKLFRVSQENENVGK
GKEAFSMTFGSPEFSSPEDTNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQ
ERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSV
SISHTKCSLLGDISDGKNLVPNKCFTSFKNNSKEKCSLKHQTRNQCQNNPSEIIQSTYQE
TQNKSSSLSTSSILSQHKENNLDLTSRFKEQEMSNGIDKQYSNCTTIDKQICTNKYKEKI
INENYNPKFFGNLQSDDSKKNDSKIKVTVLEMSEYLNKYESMSSNKDSKRPKTCEQNTQL
NSIENYLNKDNEGFKCKKSDQLKNEQDKQEDPTNEKSQNYSQRRSIKDCLSTCEQPKNTE
VLRTTLKHSNVWRKHNFHSLDGTSTRAFHPQTGLPLLSSPVPQRKTQSGCFDLDSSLLHL
KSFSSRSPRPCLNIEDDPDIHEKPFLSSSAPPITSLSLLGNFEESVLNYRFDPLGIVDGF
TAEVGASGAFCPTHLTLPVEVSFYSVSDDNAPSPYMGVITLESLGKRGYRVPPSGTIQVT
LFNPNKTVVKMFVVIYDLRDMPANHQTFLRQRTFSVPVKQEVKRSVNKENIRHTEERLLR
YLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKSYTESPTNPQFSPRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32MH5	1.000	1.000	0.000	1076	1.000	1.000	Q32MH5.pdb.gz	ATOSA_HUMAN Atos homolog protein A OS=Homo sapiens OX=9606 GN=ATOSA PE=1 SV=2
2	PDB:2v64A	0.096	0.341	8.693E-5	210	0.024	0.124	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
3	PDB:3abdA	0.099	0.415	3.043E-4	180	0.028	0.167	3abdA.pdb.gz	Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase {zeta} and REV1
4	PDB:4aezH	0.096	0.404	3.584E-4	185	0.020	0.119	4aezH.pdb.gz
5	AFDB:Q2EG98	0.047	0.031	8.234E-4	2201	0.114	0.056	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
6	AFDB:X2JEI9	0.063	0.027	3.214E-3	2206	0.125	0.061	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
7	AFDB:Q20684	0.051	0.048	3.394E-3	1245	0.112	0.096	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
8	PDB:6keaD	0.107	0.173	7.997E-3	584	0.029	0.053	6keaD.pdb.gz
9	AFDB:F4JUD2	0.045	0.048	9.050E-3	969	0.099	0.110	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
10	AFDB:Q5RJ80	0.048	0.053	1.125E-2	914	0.105	0.124	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
11	AFDB:Q24212	0.038	0.034	1.399E-2	1262	0.080	0.068	Q24212.pdb.gz	STNB_DROME Protein stoned-B OS=Drosophila melanogaster OX=7227 GN=stnB PE=1 SV=4
12	PDB:4trkA	0.090	0.312	2.251E-2	242	0.013	0.058	4trkA.pdb.gz
13	PDB:7lxdE	0.106	0.422	2.511E-2	205	0.027	0.141	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
14	PDB:2d3pA	0.050	0.149	2.956E-2	236	0.013	0.059	2d3pA.pdb.gz	Crystal structures of Cratylia floribunda seed lectin at acidic and basic pHs. Insights into the structural basis of the pH-dependent dimer-tetramer transition.
15	AFDB:Q86TB3	0.053	0.032	3.731E-2	2170	0.112	0.055	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
16	AFDB:Q9SJM3	0.039	0.042	3.939E-2	949	0.085	0.096	Q9SJM3.pdb.gz	KIPK2_ARATH Serine/threonine-protein kinase KIPK2 OS=Arabidopsis thaliana OX=3702 GN=KIPK2 PE=1 SV=1
17	PDB:1u0tB	0.038	0.109	4.827E-2	276	0.015	0.058	1u0tB.pdb.gz
18	AFDB:Q68CZ2	0.075	0.061	5.462E-2	1445	0.135	0.100	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
19	PDB:2a7aA	0.047	0.143	1.287E-1	237	0.019	0.084	2a7aA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
20	PDB:2oh5A	0.053	0.146	1.287E-1	248	0.026	0.113	2oh5A.pdb.gz	The molecular organization of cypovirus polyhedra.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q32MH5	0.0	2234	1076	1.000	1.000	ATOSA_HUMAN Atos homolog protein A OS=Homo sapiens OX=9606 GN=ATOSA PE=1 SV=2
2	Q7L5A3	2.63e-75	260	538	0.113	0.227	ATOSB_HUMAN Atos homolog protein B OS=Homo sapiens OX=9606 GN=ATOSB PE=1 SV=1
3	A0A6M3Q835	2.36e-41	168	1338	0.086	0.070	A0A6M3Q835_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=atos PE=3 SV=1
4	Q10140	6.50e-07	55.1	338	0.044	0.139	YAS4_SCHPO Uncharacterized protein C3H8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.04 PE=4 SV=1
5	Q9P4X1	0.97	35.8	632	0.027	0.046	YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC959.05c PE=3 SV=4
6	O13909	1.3	35.4	441	0.026	0.063	YDW1_SCHPO Uncharacterized protein C23C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23C11.01 PE=4 SV=1
7	Q8IDX6	4.9	33.9	3130	0.020	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
8	O64564	6.1	32.0	162	0.019	0.123	HS185_ARATH 18.5 kDa class IV heat shock protein OS=Arabidopsis thaliana OX=3702 GN=HSP18.5 PE=2 SV=1
9	C0H5F4	6.4	33.5	3254	0.020	0.006	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06628 Catalase-rel	4.8e+02	12.3	Catalase-related immune-responsive
2	PF13889 Chromosome_seg	1.6e-15	68.2	Chromosome segregation during meiosis
3	PF13915 DUF4210	3e-07	42.1	Domain of unknown function (DUF4210)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296603	0.815	Recruited to ligand-activated beta-2 adrenergic receptor/ADRB2, it negatively regulates the adrenergic receptor signaling pathway . May also regulate other G-protein coupled receptors including type-1 angiotensin II receptor/AGTR1 (Probable)
2	9606.ENSP00000367880	0.748	GPI ethanolamine phosphate transferase 3
3	9606.ENSP00000376139	0.746	Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation . Binds phosphatidylinositol 3-phosphate (PtdIns3P) forming on membranes of the endoplasmic reticulum upon activation of the upstream ULK1 and PI3 kinases and is recruited at phagophore assembly sites where it regulates the elongation of nascent phagophores downstream of WIPI2 . In the cellular response to starvation, may also function together with the TSC1-TSC2 complex and RB1CC1 in th [...]
4	9606.ENSP00000223145	0.741	Glucocorticoid-induced transcript 1 protein
5	9606.ENSP00000379619	0.736	WD repeat-containing protein 72
6	9606.ENSP00000261839	0.727	Unconventional myosin-Vc
7	9606.ENSP00000384398	0.726	RNA-binding protein MEX3D
8	9606.ENSP00000260443	0.710	Probable ribosome biogenesis protein RLP24
9	9606.ENSP00000299338	0.705	Protein FAM227B
10	9606.ENSP00000261842	0.690	AP-4 complex subunit epsilon-1
11	9606.ENSP00000455625	0.676	cAMP-regulated phosphoprotein 19
12	9606.ENSP00000255608	0.656	BTB/POZ domain-containing protein 2
13	9606.ENSP00000385722	0.652	Integrator complex subunit 1
14	9606.ENSP00000380524	0.634	Calcyphosin-like protein
15	9606.ENSP00000261845	0.621	Mitogen-activated protein kinase 6
16	9606.ENSP00000357475	0.610	Phospholipid-transporting ATPase ID
17	9606.ENSP00000328269	0.603	High mobility group 20B
18	9606.ENSP00000461785	0.594	Ras-related protein Rab-40B
19	9606.ENSP00000381553	0.582	Cilia- and flagella-associated protein 53
20	9606.ENSP00000423602	0.563	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.989	biological regulation
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.967	positive regulation of biological process
GO:0019222	0.894	regulation of metabolic process
GO:0031323	0.620	regulation of cellular metabolic process
GO:0050896	0.570	response to stimulus
GO:0048522	0.528	positive regulation of cellular process
GO:0051716	0.520	cellular response to stimulus
GO:0009893	0.422	positive regulation of metabolic process
GO:0031325	0.402	positive regulation of cellular metabolic process
GO:0060255	0.377	regulation of macromolecule metabolic process
GO:0008152	0.365	metabolic process
GO:0006950	0.364	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005737	0.932	cytoplasm
GO:0032991	0.922	protein-containing complex
GO:0016020	0.895	membrane
GO:0043233	0.825	organelle lumen
GO:0070013	0.770	intracellular organelle lumen
GO:0031981	0.760	nuclear lumen
GO:0005829	0.637	cytosol
GO:0012505	0.493	endomembrane system
GO:0005654	0.422	nucleoplasm
GO:0043232	0.340	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]