StarFunc result for job id Q32MK0

User Input

>input (819 residues)
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32MK0	1.000	1.000	0.000	819	1.000	1.000	Q32MK0.pdb.gz	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
2	AFDB:Q3UIZ8	0.551	0.566	5.103E-81	795	0.679	0.699	Q3UIZ8.pdb.gz	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
3	AFDB:Q86YV6	0.356	0.745	1.768E-44	388	0.263	0.554	Q86YV6.pdb.gz	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
4	PDB:2x4fA	0.342	0.951	2.328E-37	289	0.243	0.689	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
5	PDB:2yaaA	0.335	0.890	1.936E-28	300	0.154	0.420	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
6	PDB:5u6yA	0.331	0.583	4.757E-24	459	0.120	0.214	5u6yA.pdb.gz
7	PDB:3soaA	0.332	0.611	2.011E-22	436	0.116	0.218	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
8	PDB:8bfsA	0.300	0.847	4.473E-21	274	0.122	0.365	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
9	PDB:4rgjA	0.303	0.525	5.830E-20	463	0.117	0.207	4rgjA.pdb.gz
10	PDB:6tcaA	0.293	0.652	7.220E-20	345	0.110	0.261	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
11	PDB:6b1uA	0.298	0.537	4.952E-19	442	0.103	0.190	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	PDB:4zhxA	0.297	0.577	5.224E-19	409	0.103	0.205	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
13	PDB:4eomC	0.290	0.809	5.511E-19	276	0.090	0.268	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
14	AFDB:Q9VUQ9	0.299	0.118	1.728E-15	2139	0.190	0.073	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
15	AFDB:A0A2R8QF71	0.294	0.214	4.527E-15	1140	0.203	0.146	A0A2R8QF71.pdb.gz
16	AFDB:Q0KHT7	0.309	0.373	5.914E-15	674	0.125	0.151	Q0KHT7.pdb.gz	DAPKR_DROME Death-associated protein kinase related OS=Drosophila melanogaster OX=7227 GN=Drak PE=1 SV=2
17	AFDB:Q869N2	0.304	0.293	6.582E-15	852	0.182	0.175	Q869N2.pdb.gz	PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum OX=44689 GN=pakB PE=1 SV=1
18	AFDB:P07527	0.278	0.261	1.065E-14	877	0.164	0.153	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
19	AFDB:G5EB22	0.270	0.212	3.105E-14	1050	0.156	0.122	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
20	AFDB:Q58FB8	0.282	0.217	3.455E-14	1068	0.184	0.141	Q58FB8.pdb.gz	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PT87	0.0	1024	786	0.673	0.701	MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus OX=10116 GN=Mylk3 PE=1 SV=1
2	Q32MK0	0.0	1678	819	1.000	1.000	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
3	Q3UIZ8	0.0	1060	795	0.691	0.712	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
4	A8C984	1.16e-178	532	715	0.293	0.336	MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio OX=7955 GN=mylk3 PE=2 SV=1
5	Q86YV6	8.46e-157	464	388	0.258	0.544	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
6	P07313	2.52e-150	456	608	0.256	0.345	MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK2 PE=1 SV=3
7	P20689	6.58e-149	452	610	0.253	0.339	MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus OX=10116 GN=Mylk2 PE=1 SV=2
8	Q8VCR8	8.31e-149	452	613	0.253	0.338	MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus OX=10090 GN=Mylk2 PE=1 SV=2
9	Q9H1R3	1.50e-147	448	596	0.252	0.346	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
10	G1U9Q7	5.92e-98	337	1903	0.199	0.086	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
11	Q6PDN3	1.19e-97	336	1941	0.204	0.086	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
12	Q15746	7.86e-97	334	1914	0.203	0.087	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
13	A1ZA70	5.93e-94	312	732	0.201	0.225	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
14	Q9GV79	7.02e-93	310	786	0.199	0.207	Q9GV79_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
15	Q9GTV1	9.32e-93	309	732	0.195	0.219	Q9GTV1_DROME Stretchin-MLCK OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
16	O01651	4.30e-92	311	929	0.201	0.178	O01651_DROME Myosin light chain kinase isoform-I OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
17	A0A0B4JD64	5.51e-92	311	913	0.201	0.181	A0A0B4JD64_DROME Stretchin-Mlck, isoform M OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
18	A1ZA69	9.53e-92	311	929	0.201	0.178	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
19	O01653	1.10e-91	308	832	0.201	0.198	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
20	A0A0B4JCU1	1.70e-91	301	602	0.197	0.267	A0A0B4JCU1_DROME Stretchin-Mlck, isoform N OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.1e-05	36.3	ABC1 atypical kinase-like domain
2	PF01636 APH	39	15.6	Phosphotransferase enzyme family
3	PF06293 Kdo	37	15.1	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	0.067	24.1	Kinase-like
5	PF00069 Pkinase	4.8e-68	241.0	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	3.1e-36	136.6	Protein tyrosine and serine/threonine kinase
7	PF10779 XhlA	34	16.1	Haemolysin XhlA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279022	0.938	Myosin regulatory light polypeptide 9
2	9606.ENSP00000217652	0.928	Myosin regulatory light chain 12A
3	9606.ENSP00000463559	0.928	Myosin regulatory light chain 12B
4	9606.ENSP00000223364	0.922	Myosin regulatory light chain 2, atrial isoform
5	9606.ENSP00000228841	0.884	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
6	9606.ENSP00000223167	0.860	Myosin regulatory light chain 10
7	9606.ENSP00000450385	0.855	Myosin light chain 6B
8	9606.ENSP00000383023	0.853	Myosin light chain 5
9	9606.ENSP00000347055	0.851	Myosin light chain 4
10	9606.ENSP00000325239	0.844	Myosin light chain, phosphorylatable, fast skeletal muscle
11	9606.ENSP00000446955	0.843	Myosin light polypeptide 6
12	9606.ENSP00000379210	0.838	Myosin light chain 3
13	9606.ENSP00000219097	0.820	Origin recognition complex subunit 6
14	9606.ENSP00000306124	0.805	Protein kinase C epsilon type
15	9606.ENSP00000400175	0.716	Transforming protein RhoA
16	9606.ENSP00000389168	0.715	Protein phosphatase 1 regulatory subunit 12A
17	9606.ENSP00000262873	0.700	Myosin-7B
18	9606.ENSP00000301242	0.681	Protein phosphatase 1 regulatory subunit 14A
19	9606.ENSP00000272298	0.678	Calmodulin 2 (phosphorylase kinase, delta)
20	9606.ENSP00000304643	0.658	Calmodulin-like protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004687	0.996	myosin light chain kinase activity
GO:0004683	0.722	calmodulin-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.987	biological regulation
GO:0032501	0.979	multicellular organismal process
GO:0050789	0.952	regulation of biological process
GO:0050794	0.844	regulation of cellular process
GO:0050896	0.795	response to stimulus
GO:0044237	0.638	cellular metabolic process
GO:0032502	0.635	developmental process
GO:0051716	0.629	cellular response to stimulus
GO:0048856	0.581	anatomical structure development
GO:0065008	0.565	regulation of biological quality
GO:0071840	0.501	cellular component organization or biogenesis
GO:0016310	0.492	phosphorylation
GO:0071704	0.483	organic substance metabolic process
GO:0044238	0.481	primary metabolic process
GO:0006468	0.467	protein phosphorylation
GO:0016043	0.450	cellular component organization
GO:0003008	0.431	system process
GO:0048518	0.367	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.997	organelle
GO:0005829	0.989	cytosol
GO:0043229	0.985	intracellular organelle
GO:0043227	0.896	membrane-bounded organelle
GO:0043228	0.742	non-membrane-bounded organelle
GO:0043232	0.730	intracellular non-membrane-bounded organelle
GO:0043231	0.617	intracellular membrane-bounded organelle
GO:0005634	0.412	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22004	0.996	ATP + L-seryl-[myosin light chain] = ADP + H(+) + O-phospho-L-seryl-[myosin light chain]
EC:2.7.11.18	0.996	[myosin light-chain] kinase.
EC:2.7.11.17	0.722	calcium/calmodulin-dependent protein kinase.

[back to server]