StarFunc result for job id Q32MQ0

User Input

>input (723 residues)
MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCKNSITLVSEQD
RVPKCPKSNSLDPKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSAREDIKENLELQAR
GTHRCLGQKPALHRASPCKSPAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPE
TLALHNPTAKAVSFHTKSAFHTPGYPWKAGSPFLPPEFPHKISSTKGLGAISPYMHPTIP
EYPPHFYTEHGLATIYSPYLLAGSSPECDAPLLSVYGTQDPRHFLPHPGPIPKHLAPSPA
TYDHYRFFQQYPSNLPIPYGFYRPESAFSSYGLRLPPVTGLTRDQSSHLLEEATLVYPAS
SPSRLNPSDPNRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF
MQTSQTCEGLYDLSNKAASSALGRLYPPEQSLTAFRPVKKSTECLPAQAAETTAESPVSL
NVVNGDPPAPTGSASLVSEAAPSSPDDSSGMGPLNLSKKSEINLAATHEPTYQGSPQAET
ASFSELQDLPLNLSVKDPCNTQAPRPAFPGRPRAAEPAAAVPQKTGTEGSEDGPSHPETK
PGSLDGDGAPPTGPGEEAPDACAVDSSEEQKQTAAVALCQLAAYSPRNIRVGDGDAAAPE
PACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQGAKKAKLQDTARVFTLRRRA
RVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32MQ0	0.999	0.999	0.000	723	1.000	1.000	Q32MQ0.pdb.gz	ZN750_HUMAN Zinc finger protein 750 OS=Homo sapiens OX=9606 GN=ZNF750 PE=1 SV=1
2	AFDB:Q06738	0.050	0.051	1.426E-3	710	0.145	0.148	Q06738.pdb.gz	RD29A_ARATH Low-temperature-induced 78 kDa protein OS=Arabidopsis thaliana OX=3702 GN=RD29A PE=1 SV=2
3	AFDB:Q9DB00	0.042	0.019	8.147E-3	2260	0.154	0.049	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
4	AFDB:A0A2R6X6S3	0.049	0.044	3.709E-2	911	0.158	0.125	A0A2R6X6S3.pdb.gz	SOK_MARPO Protein SOSEKI OS=Marchantia polymorpha OX=3197 GN=SOK PE=1 SV=1
5	AFDB:Q9XER9	0.058	0.036	7.913E-2	1392	0.133	0.069	Q9XER9.pdb.gz	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
6	AFDB:O14064	0.052	0.041	1.156E-1	997	0.142	0.103	O14064.pdb.gz	BIR1_SCHPO Protein bir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bir1 PE=1 SV=1
7	AFDB:Q9ULL8	0.047	0.026	1.156E-1	1493	0.152	0.074	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
8	AFDB:Q0WNQ5	0.055	0.042	1.821E-1	1025	0.155	0.109	Q0WNQ5.pdb.gz	Q0WNQ5_ARATH LONGIFOLIA protein OS=Arabidopsis thaliana OX=3702 GN=TRM4 PE=1 SV=1
9	AFDB:A0A0A0MRJ9	0.054	0.045	2.466E-1	890	0.130	0.106	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
10	AFDB:P51827	0.049	0.033	2.466E-1	1254	0.176	0.101	P51827.pdb.gz	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q32MQ0	0.0	1464	723	1.000	1.000	ZN750_HUMAN Zinc finger protein 750 OS=Homo sapiens OX=9606 GN=ZNF750 PE=1 SV=1
2	P0CG20	1.82e-21	101	571	0.055	0.070	PRR35_HUMAN Proline-rich protein 35 OS=Homo sapiens OX=9606 GN=PRR35 PE=1 SV=1
3	Q6FLR3	1.2	34.7	447	0.033	0.054	Q6FLR3_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ANP1 PE=4 SV=1
4	P54257	2.2	34.3	671	0.039	0.042	HAP1_HUMAN Huntingtin-associated protein 1 OS=Homo sapiens OX=9606 GN=HAP1 PE=1 SV=3
5	G3V6S0	3.0	33.9	2361	0.041	0.013	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
6	Q6XD99	3.0	33.9	2358	0.041	0.013	Q6XD99_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1
7	O23240	4.5	33.1	559	0.025	0.032	D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=D2HGDH PE=1 SV=3
8	Q9H4Z2	6.6	32.7	1342	0.040	0.022	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
9	G3V893	7.8	32.3	1336	0.040	0.022	ZN335_RAT Zinc finger protein 335 OS=Rattus norvegicus OX=10116 GN=Znf335 PE=1 SV=1
10	A2A5K6	8.7	32.3	1337	0.040	0.022	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15269 zf-C2H2_7	7.9e-33	123.6	Zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269394

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363804	0.707	Krueppel-like factor 4
2	9606.ENSP00000319979	0.699	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1
3	9606.ENSP00000288955	0.697	Grainyhead-like protein 3 homolog
4	9606.ENSP00000222032	0.668	Cornifelin
5	9606.ENSP00000383042	0.632	Lysine-specific histone demethylase 1A
6	9606.ENSP00000269373	0.608	Ketosamine-3-kinase
7	9606.ENSP00000278949	0.568	Myelin protein zero-like protein 3
8	9606.ENSP00000347719	0.558	Tubulin-specific chaperone D
9	9606.ENSP00000337862	0.553	Putative transcription factor Ovo-like 1
10	9606.ENSP00000264731	0.538	Tumor protein 63
11	9606.ENSP00000378710	0.538	Protein FAM135B
12	9606.ENSP00000406229	0.527	Protocadherin Fat 1
13	9606.ENSP00000337991	0.518	Protein SPT2 homolog
14	9606.ENSP00000261800	0.513	Protocadherin Fat 2
15	9606.ENSP00000301067	0.509	Histone-lysine N-methyltransferase 2D
16	9606.ENSP00000458715	0.509	Caspase recruitment domain-containing protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990841	1.000	promoter-specific chromatin binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0048856	0.961	anatomical structure development
GO:0045944	0.954	positive regulation of transcription by RNA polymerase II
GO:0050793	0.899	regulation of developmental process
GO:0048523	0.891	negative regulation of cellular process
GO:0010605	0.844	negative regulation of macromolecule metabolic process
GO:0045934	0.810	negative regulation of nucleobase-containing compound metabolic process
GO:0009888	0.795	tissue development
GO:0051239	0.787	regulation of multicellular organismal process
GO:0051253	0.786	negative regulation of RNA metabolic process
GO:0000122	0.780	negative regulation of transcription by RNA polymerase II
GO:0009987	0.740	cellular process
GO:0008544	0.390	epidermis development
GO:0045595	0.366	regulation of cell differentiation
GO:0050896	0.347	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.598	cytoplasm
GO:0005654	0.445	nucleoplasm
GO:0005829	0.390	cytosol
GO:0032991	0.347	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]