StarFunc result for job id Q32MZ4

User Input

>input (808 residues)
MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRR
SRRNTSASDEDERMSVGSRGSLRVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGS
GDTSISIDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQ
LDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEA
LKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKMTKEELNALKSTGDGTLGRAS
EVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCVDIEVFPAGENTEDQKSSEDTAPFLG
TLAGATYEEQVQSQILESSSLPENTVQVESNEVMGAPDDRTRTPLEPSNCWSDLDGGNHT
ENVGEAAVTQVEEQAGTVASCPLGHSDDTVYHDDKCMVEVPQELETSTGHSLEKEFTNQE
AAEPKEVPAHSTEVGRDHNEEEGEETGLRDEKPIKTEVPGSPAGTEGNCQEATGPSTVDT
QNEPLDMKEPDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNT
DLSEIKEEEQVKSTDRKSAVEAQNEVTENPKQKIAAESSENVDCPENPKIKLDGKLDQEG
DDVQTAAEEVLADGDTLDFEDDTVQSSGPRAGGEELDEGVAKDNAKIDGATQSSPAEPKS
EDADRCTLPEHESPSQDISDACEAESTERCEMSEHPSQTVRKALDSNSLENDDLSAPGRE
PGHFNPESREDTRGGNEKGKSKEDCTMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32MZ4	1.000	1.000	0.000	808	1.000	1.000	Q32MZ4.pdb.gz	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
2	AFDB:A0A0F7NGI8	0.170	0.182	4.115E-89	752	0.926	0.995	A0A0F7NGI8.pdb.gz	A0A0F7NGI8_HUMAN Leucine rich repeat (In FLII) interacting protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=2 SV=1
3	AFDB:Q3UZ39	0.211	0.228	8.883E-39	729	0.486	0.539	Q3UZ39.pdb.gz	LRRF1_MOUSE Leucine-rich repeat flightless-interacting protein 1 OS=Mus musculus OX=10090 GN=Lrrfip1 PE=1 SV=2
4	AFDB:Q86V48	0.072	0.055	6.528E-5	1076	0.179	0.135	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
5	AFDB:Q9JM52	0.109	0.073	1.652E-4	1308	0.130	0.080	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
6	AFDB:A0A0G2K7W4	0.102	0.068	1.774E-4	1348	0.166	0.099	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
7	AFDB:Q8R4U7	0.067	0.052	2.198E-4	1068	0.163	0.124	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
8	AFDB:F1LP90	0.113	0.074	6.415E-4	1336	0.129	0.078	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
9	AFDB:Q7Z6P3	0.147	0.120	6.890E-4	1021	0.129	0.102	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
10	AFDB:A0A0G2K490	0.094	0.060	7.400E-4	1360	0.139	0.082	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
11	PDB:7r5jV0	0.056	0.145	3.349	273	0.041	0.121	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7z36B	0.110	0.178	4.149	446	0.031	0.056	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
13	PDB:8escS	0.038	0.085	9.775	268	0.025	0.075	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0F7NGI8	0.0	1406	752	0.931	1.000	A0A0F7NGI8_HUMAN Leucine rich repeat (In FLII) interacting protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=2 SV=1
2	Q32MZ4	0.0	1645	808	1.000	1.000	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
3	Q3UZ39	0.0	545	729	0.520	0.576	LRRF1_MOUSE Leucine-rich repeat flightless-interacting protein 1 OS=Mus musculus OX=10090 GN=Lrrfip1 PE=1 SV=2
4	Q9Y608	7.81e-53	198	721	0.132	0.148	LRRF2_HUMAN Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1
5	Q6GNW0	2.23e-47	182	729	0.137	0.152	LRRF2_XENLA Leucine-rich repeat flightless-interacting protein 2 OS=Xenopus laevis OX=8355 GN=lrrfip2 PE=2 SV=2
6	Q91WK0	4.92e-46	172	415	0.137	0.267	LRRF2_MOUSE Leucine-rich repeat flightless-interacting protein 2 OS=Mus musculus OX=10090 GN=Lrrfip2 PE=1 SV=1
7	Q9VXN3	3.56e-07	55.8	396	0.078	0.159	Q9VXN3_DROME LD07988p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8578 PE=1 SV=2
8	D2D0C0	0.31	37.0	426	0.036	0.068	D2D0C0_DANRE Neuronal pentraxin 2b OS=Danio rerio OX=7955 GN=nptx2b PE=2 SV=1
9	Q9CA42	1.7	34.7	1085	0.040	0.029	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1
10	Q8VIL3	3.6	33.1	266	0.032	0.098	ZWINT_RAT ZW10 interactor OS=Rattus norvegicus OX=10116 GN=Zwint PE=1 SV=1
11	Q9CQU5	3.7	33.1	252	0.032	0.103	ZWINT_MOUSE ZW10 interactor OS=Mus musculus OX=10090 GN=Zwint PE=1 SV=1
12	Q9XZ29	5.5	33.1	1212	0.045	0.030	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09738 LRRFIP	1.2e-79	279.4	LRRFIP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324573	0.987	Protein flightless-1 homolog
2	9606.ENSP00000344456	0.860	Catenin beta-1
3	9606.ENSP00000318690	0.814	GC-rich sequence DNA-binding factor 2
4	9606.ENSP00000357113	0.810	Gamma-interferon-inducible protein 16
5	9606.ENSP00000401399	0.785	Myeloid differentiation primary response protein MyD88
6	9606.ENSP00000417078	0.753	ATP-dependent RNA helicase DHX36
7	9606.ENSP00000278980	0.734	COMM domain-containing protein 7
8	9606.ENSP00000422753	0.709	Probable ATP-dependent RNA helicase DDX41
9	9606.ENSP00000356520	0.706	ATP-dependent RNA helicase A
10	9606.ENSP00000259365	0.700	Tropomodulin-1
11	9606.ENSP00000357112	0.692	Interferon-inducible protein AIM2
12	9606.ENSP00000229395	0.677	FGFR1 oncogene partner 2
13	9606.ENSP00000354394	0.677	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000264657	0.664	Signal transducer and activator of transcription 3
15	9606.ENSP00000341208	0.652	Signal transducer and activator of transcription 5A
16	9606.ENSP00000293328	0.650	Signal transducer and activator of transcription 5B
17	9606.ENSP00000463058	0.642	RNA-binding protein 8A
18	9606.ENSP00000479904	0.637	Zinc finger MYM-type protein 2
19	9606.ENSP00000417229	0.634	Eukaryotic translation initiation factor 2A
20	9606.ENSP00000437073	0.634	Unconventional myosin-XVIIIa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	0.999	RNA binding
GO:0050839	0.998	cell adhesion molecule binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001217	0.997	DNA-binding transcription repressor activity
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042803	0.997	protein homodimerization activity
GO:0045296	0.990	cadherin binding
GO:0003725	0.990	double-stranded RNA binding
GO:0001227	0.985	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0080090	0.992	regulation of primary metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0048523	0.977	negative regulation of cellular process
GO:0009889	0.976	regulation of biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.974	negative regulation of macromolecule metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0051172	0.973	negative regulation of nitrogen compound metabolic process
GO:0031324	0.971	negative regulation of cellular metabolic process
GO:0006355	0.950	regulation of DNA-templated transcription
GO:0006357	0.926	regulation of transcription by RNA polymerase II
GO:0051253	0.906	negative regulation of RNA metabolic process
GO:0009890	0.888	negative regulation of biosynthetic process
GO:1903507	0.876	negative regulation of nucleic acid-templated transcription
GO:0045892	0.814	negative regulation of DNA-templated transcription
GO:0000122	0.429	negative regulation of transcription by RNA polymerase II
GO:0048518	0.316	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043229	0.995	intracellular organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0005634	0.889	nucleus
GO:0005856	0.709	cytoskeleton
GO:0070013	0.369	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen
GO:0005654	0.314	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]