StarFunc result for job id Q32P44

User Input

>input (896 residues)
MDGAAGPGDGPAREALQSLSQRLRVQEQEMELVKAALAEALRLLRLQVPPSSLQGSGTPA
PPGDSLAAPPGLPPTCTPSLVSRGTQTETEVELKSSPGPPGLSNGPPAPQGASEEPSGTQ
SEGGGSSSSGAGSPGPPGILRPLQPPQRADTPRRNSSSSSSPSERPRQKLSRKAISSANL
LVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELP
SGPPPETLSLDWVYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQRH
YRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFER
GVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMKLAEIKSTNDSVLAVGFNPRDSSC
IVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEG
NILTWGRSPSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLSGGGRDRRLVQ
WGPGLVALQEAEIPEHFGAVRAIAEGLGSELLVGTTKNALLRGDLAQGFSPVIQGHTDEL
WGLCTHPSQNRFLTCGHDRQLCLWDGESHALAWSIDLKETGLCADFHPSGAVVAVGLNTG
RWLVLDTETREIVSDVIDGNEQLSVVRYSPDGLYLAIGSHDNVIYIYSVSSDGAKSSRFG
RCMGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKQLKNRYESRDREWATYTCVL
GFHVYGVWPDGSDGTDINSLCRSHNERVVAVADDFCKVHLFQYPCARAKAPSRMYGGHGS
HVTSVRFTHDDSHLVSLGGKDASIFQWRVLGAGGAGPAPATPSRTPSLSPASSLDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32P44	1.000	1.000	0.000	896	1.000	1.000	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
2	AFDB:B5MBZ0	0.715	0.646	8.198E-99	992	0.496	0.448	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
3	AFDB:Q3UMY5	0.750	0.681	1.257E-98	988	0.498	0.451	Q3UMY5.pdb.gz	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
4	AFDB:O95834	0.692	0.952	4.010E-84	649	0.386	0.533	O95834.pdb.gz	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
5	AFDB:O45487	0.658	0.661	7.693E-60	891	0.260	0.262	O45487.pdb.gz	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
6	AFDB:F1LRR4	0.526	0.317	1.021E-27	1551	0.155	0.090	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
7	PDB:7rroe	0.550	0.786	4.006E-27	610	0.113	0.166	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
8	PDB:7mqaLQ	0.457	0.487	2.946E-26	830	0.119	0.129	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:1nr0A	0.465	0.645	3.021E-25	610	0.118	0.174	1nr0A.pdb.gz
10	PDB:7mqaLO	0.430	0.464	4.633E-25	819	0.106	0.116	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7ajtUA	0.428	0.456	6.025E-24	834	0.096	0.103	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7mq8LO	0.447	0.469	1.065E-23	848	0.106	0.112	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8LR	0.272	0.309	6.479E-23	773	0.116	0.135	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajuUL	0.437	0.491	7.125E-23	779	0.114	0.131	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:5m2nA	0.446	0.538	9.474E-23	711	0.100	0.127	5m2nA.pdb.gz
16	PDB:1pguB	0.454	0.632	1.453E-22	608	0.117	0.173	1pguB.pdb.gz	The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
17	AFDB:P16649	0.186	0.228	9.181E-19	713	0.121	0.151	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
18	AFDB:Q09715	0.191	0.267	6.139E-18	614	0.123	0.179	Q09715.pdb.gz	TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup11 PE=1 SV=1
19	AFDB:F1N9Y3	0.169	0.196	1.707E-16	773	0.104	0.120	F1N9Y3.pdb.gz
20	AFDB:Q9FUY2	0.152	0.147	2.277E-14	931	0.114	0.110	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RMY7	0.0	788	817	0.455	0.499	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
2	B5MBZ0	0.0	891	992	0.504	0.456	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
3	E7EXY5	0.0	785	813	0.452	0.498	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
4	O00423	0.0	770	815	0.450	0.494	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
5	O95834	0.0	712	649	0.387	0.535	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
6	Q05BC3	0.0	767	814	0.452	0.498	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
7	Q32P44	0.0	1816	896	1.000	1.000	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
8	Q3UMY5	0.0	889	988	0.506	0.459	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
9	Q6P6T4	0.0	712	649	0.387	0.535	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
10	Q9HC35	0.0	885	981	0.503	0.460	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
11	A0A0C4DGQ7	9.74e-139	421	427	0.233	0.489	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
12	Q9VUI3	1.37e-104	350	1076	0.251	0.209	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
13	Q05BV3	2.43e-91	320	1969	0.233	0.106	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
14	O45487	3.10e-77	271	891	0.218	0.219	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
15	C4ALD8	3.27e-77	271	888	0.218	0.220	C4ALD8_CAEEL HELP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
16	A8J1V4	1.26e-13	77.8	1764	0.098	0.050	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
17	Q7KLW9	4.66e-12	72.0	505	0.071	0.127	Q7KLW9_DROME Pre-mRNA-processing factor 19 OS=Drosophila melanogaster OX=7227 GN=Prp19 PE=1 SV=1
18	F1M5K2	4.30e-11	69.7	1551	0.172	0.099	F1M5K2_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=2
19	A0A0G2JZG6	5.34e-11	69.3	1526	0.172	0.101	A0A0G2JZG6_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=1
20	A2CEH0	7.64e-11	67.8	490	0.075	0.137	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	6.9e-05	34.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF03178 CPSF_A	4.2e+02	11.6	CPSF A subunit region
3	PF07433 DUF1513	4.6e+02	11.2	Protein of unknown function (DUF1513)
4	PF18975 DUF5711	5.7e+02	11.1	Family of unknown function (DUF5711)
5	PF03451 HELP	1.2e-23	94.1	HELP motif
6	PF20426 NBCH_WD40	3.9	17.8	Neurobeachin beta propeller domain
7	PF00400 WD40	1.1e-20	84.8	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317817	0.689	SH2 domain-containing protein 3C
2	9606.ENSP00000170168	0.616	RNA exonuclease 1 homolog
3	9606.ENSP00000341905	0.606	RAS protein activator like-3
4	9606.ENSP00000310547	0.597	Uncharacterized aarF domain-containing protein kinase 5
5	9606.ENSP00000320924	0.565	WAS/WASL-interacting protein family member 2
6	9606.ENSP00000471455	0.565	Coiled-coil domain-containing protein 124
7	9606.ENSP00000325808	0.560	LRRN4 C-terminal-like protein
8	9606.ENSP00000325091	0.543	Leucine rich repeats and calponin homology domain containing 2
9	9606.ENSP00000363944	0.511	Ribosomal biogenesis protein LAS1L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043621	0.999	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0009987	0.979	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0071840	0.953	cellular component organization or biogenesis
GO:0016043	0.918	cellular component organization
GO:1903047	0.866	mitotic cell cycle process
GO:0140014	0.836	mitotic nuclear division
GO:0032886	0.831	regulation of microtubule-based process
GO:0000070	0.825	mitotic sister chromatid segregation
GO:0033043	0.818	regulation of organelle organization
GO:0044087	0.813	regulation of cellular component biogenesis
GO:0051726	0.800	regulation of cell cycle
GO:0051493	0.774	regulation of cytoskeleton organization
GO:0051179	0.765	localization
GO:0051303	0.745	establishment of chromosome localization
GO:0010564	0.744	regulation of cell cycle process
GO:0051310	0.735	metaphase plate congression
GO:0007080	0.701	mitotic metaphase plate congression
GO:0070507	0.695	regulation of microtubule cytoskeleton organization
GO:1902115	0.625	regulation of organelle assembly
GO:0090224	0.487	regulation of spindle organization
GO:0048519	0.359	negative regulation of biological process
GO:0060236	0.318	regulation of mitotic spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005856	0.992	cytoskeleton
GO:0015630	0.979	microtubule cytoskeleton
GO:0043227	0.966	membrane-bounded organelle
GO:0005634	0.964	nucleus
GO:0005829	0.948	cytosol
GO:0005819	0.870	spindle
GO:0099080	0.856	supramolecular complex
GO:0016020	0.837	membrane
GO:0072686	0.810	mitotic spindle
GO:0099512	0.787	supramolecular fiber
GO:0099513	0.750	polymeric cytoskeletal fiber
GO:0005874	0.718	microtubule
GO:0030496	0.671	midbody
GO:0005654	0.611	nucleoplasm
GO:0005876	0.445	spindle microtubule
GO:0032991	0.331	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]