StarFunc result for job id Q32ZL2

User Input

>input (321 residues)
MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS
SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV
RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN
PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN
RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV
ESPLEKVTSVQNHITAFAEVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BJ52	0.870	0.870	8.417E-46	321	0.956	0.956	Q8BJ52.pdb.gz	PLPR5_MOUSE Phospholipid phosphatase-related protein type 5 OS=Mus musculus OX=10090 GN=Plppr5 PE=2 SV=1
2	AFDB:A0A024R154	0.830	0.820	6.212E-30	325	0.548	0.542	A0A024R154.pdb.gz
3	AFDB:Q96GM1	0.799	0.750	2.422E-28	343	0.470	0.440	Q96GM1.pdb.gz	PLPR2_HUMAN Phospholipid phosphatase-related protein type 2 OS=Homo sapiens OX=9606 GN=PLPPR2 PE=1 SV=1
4	AFDB:Q7TMB7	0.760	0.329	3.997E-22	766	0.312	0.131	Q7TMB7.pdb.gz	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
5	AFDB:Q7TPB0	0.776	0.359	4.670E-21	716	0.352	0.158	Q7TPB0.pdb.gz	PLPR3_MOUSE Phospholipid phosphatase-related protein type 3 OS=Mus musculus OX=10090 GN=Plppr3 PE=1 SV=1
6	AFDB:O08564	0.712	0.806	3.837E-17	282	0.231	0.262	O08564.pdb.gz	PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Plpp1 PE=1 SV=1
7	AFDB:O88956	0.722	0.809	1.344E-16	285	0.215	0.242	O88956.pdb.gz	PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus OX=10141 GN=PLPP1 PE=1 SV=1
8	AFDB:Q61469	0.700	0.789	2.176E-16	283	0.212	0.240	Q61469.pdb.gz	PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus OX=10090 GN=Plpp1 PE=1 SV=1
9	AFDB:O43688	0.699	0.774	3.358E-16	288	0.215	0.240	O43688.pdb.gz	PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens OX=9606 GN=PLPP2 PE=1 SV=1
10	AFDB:P97544	0.728	0.747	1.068E-15	312	0.255	0.263	P97544.pdb.gz	PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus OX=10116 GN=Plpp3 PE=1 SV=1
11	PDB:6bw5D	0.121	0.111	3.605E-1	362	0.121	0.108	6bw5D.pdb.gz	GlcNAc-1-P-transferase-tunicamycin complex structure reveals basis for inhibition of N-glycosylation.
12	PDB:7xp4R	0.132	0.139	6.125E-1	299	0.128	0.137	7xp4R.pdb.gz
13	PDB:7ccsB	0.116	0.094	7.428E-1	454	0.112	0.079	7ccsB.pdb.gz
14	PDB:2b6pA	0.169	0.198	9.008E-1	261	0.093	0.115	2b6pA.pdb.gz
15	PDB:7f04C	0.155	0.183	9.452E-1	231	0.087	0.121	7f04C.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
16	PDB:5sv0A	0.147	0.192	1.092	233	0.081	0.112	5sv0A.pdb.gz
17	PDB:6caaA	0.109	0.091	1.262	477	0.156	0.105	6caaA.pdb.gz
18	PDB:7c9iC	0.147	0.174	1.390	243	0.087	0.115	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
19	PDB:4ntaA	0.175	0.295	1.459	147	0.075	0.163	4ntaA.pdb.gz
20	PDB:6g7oA	0.151	0.141	1.531	350	0.097	0.089	6g7oA.pdb.gz	Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BJ52	0.0	638	321	0.956	0.956	PLPR5_MOUSE Phospholipid phosphatase-related protein type 5 OS=Mus musculus OX=10090 GN=Plppr5 PE=2 SV=1
2	Q8TBJ4	2.33e-133	384	325	0.548	0.542	PLPR1_HUMAN Phospholipid phosphatase-related protein type 1 OS=Homo sapiens OX=9606 GN=PLPPR1 PE=1 SV=1
3	Q6WAY2	2.73e-131	378	325	0.539	0.532	PLPR1_RAT Phospholipid phosphatase-related protein type 1 OS=Rattus norvegicus OX=10116 GN=Plppr1 PE=2 SV=1
4	Q96GM1	2.36e-106	316	343	0.483	0.452	PLPR2_HUMAN Phospholipid phosphatase-related protein type 2 OS=Homo sapiens OX=9606 GN=PLPPR2 PE=1 SV=1
5	Q7TME0	1.54e-48	175	766	0.308	0.129	PLPR4_MOUSE Phospholipid phosphatase-related protein type 4 OS=Mus musculus OX=10090 GN=Plppr4 PE=1 SV=2
6	Q7Z2D5	3.47e-48	174	763	0.308	0.130	PLPR4_HUMAN Phospholipid phosphatase-related protein type 4 OS=Homo sapiens OX=9606 GN=PLPPR4 PE=1 SV=1
7	Q7TPB0	6.99e-47	170	716	0.327	0.147	PLPR3_MOUSE Phospholipid phosphatase-related protein type 3 OS=Mus musculus OX=10090 GN=Plppr3 PE=1 SV=1
8	Q7TMB7	2.13e-46	169	766	0.302	0.127	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
9	O88956	2.18e-33	126	285	0.224	0.253	PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus OX=10141 GN=PLPP1 PE=1 SV=1
10	Q61469	8.93e-33	124	283	0.212	0.240	PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus OX=10090 GN=Plpp1 PE=1 SV=1
11	Q99JY8	5.51e-32	123	312	0.237	0.244	PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus OX=10090 GN=Plpp3 PE=1 SV=1
12	O43688	1.47e-31	121	288	0.234	0.260	PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens OX=9606 GN=PLPP2 PE=1 SV=1
13	O08564	1.57e-31	121	282	0.218	0.248	PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Plpp1 PE=1 SV=1
14	P97544	1.98e-31	121	312	0.237	0.244	PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus OX=10116 GN=Plpp3 PE=1 SV=1
15	O14494	3.99e-31	120	284	0.224	0.254	PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens OX=9606 GN=PLPP1 PE=1 SV=1
16	P60588	8.90e-31	119	285	0.212	0.239	PLPP1_PIG Phospholipid phosphatase 1 OS=Sus scrofa OX=9823 GN=PLPP1 PE=1 SV=2
17	O14495	9.75e-31	119	311	0.227	0.235	PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens OX=9606 GN=PLPP3 PE=1 SV=1
18	Q8K593	9.13e-28	111	276	0.231	0.268	PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Plpp2 PE=2 SV=1
19	Q9V576	1.93e-25	106	379	0.212	0.179	WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=wun PE=1 SV=2
20	A0A0B4LEJ6	7.11e-23	97.1	246	0.221	0.289	A0A0B4LEJ6_DROME Wunen-2, isoform B OS=Drosophila melanogaster OX=7227 GN=wun2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20485 DUF6724	1.9e+02	13.3	Family of unknown function (DUF6724)
2	PF04120 Iron_permease	8.9e+02	11.1	Low affinity iron permease
3	PF04478 Mid2	2.6e+02	12.8	Mid2 like cell wall stress sensor
4	PF01569 PAP2	1.7e-18	78.2	PAP2 superfamily
5	PF01034 Syndecan	3.3e+02	12.6	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304429	0.626	Sorting nexin-7
2	9606.ENSP00000482032	0.547	Inositol hexakisphosphate kinase 1
3	9606.ENSP00000338532	0.545	Protein FAM53B
4	9606.ENSP00000306425	0.518	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
5	9606.ENSP00000331103	0.516	Inositol hexakisphosphate kinase 2
6	9606.ENSP00000328287	0.507	E3 ubiquitin-protein ligase RNF123

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016791	0.998	phosphatase activity
GO:0008195	0.712	phosphatidate phosphatase activity
GO:0042577	0.529	lipid phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.966	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0048522	0.890	positive regulation of cellular process
GO:0044087	0.793	regulation of cellular component biogenesis
GO:0031346	0.786	positive regulation of cell projection organization
GO:0051489	0.779	regulation of filopodium assembly
GO:0044089	0.653	positive regulation of cellular component biogenesis
GO:0009987	0.607	cellular process
GO:0051491	0.605	positive regulation of filopodium assembly
GO:0010976	0.592	positive regulation of neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.988	cell periphery
GO:0005886	0.976	plasma membrane
GO:0043227	0.958	membrane-bounded organelle
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0005737	0.812	cytoplasm
GO:0005634	0.577	nucleus
GO:0012505	0.396	endomembrane system
GO:0031974	0.361	membrane-enclosed lumen
GO:0070013	0.353	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.998	Phosphoric monoester hydrolases.
RHEA:27429	0.712	a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate
EC:3.1.3.4	0.712	phosphatidate phosphatase.

[back to server]