StarFunc result for job id Q330K2

User Input

>input (333 residues)
MAASAHGSVWGPLRLGIPGLCCRRPPLGLYARMRRLPGPEVSGRSVAAASGPGAWGTDHY
CLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKT
VEDIYCDNPPHQPVAIELWKAVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYAEN
TQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRATPYHGSRRKVFLPMDICMLHG
VSQEDFLRRNQDKNVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKK
IQRVDFDIFHPSLQQKNTLLPLYLYIQSWRKTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q330K2	1.000	1.000	5.721E-47	333	1.000	1.000	Q330K2.pdb.gz	NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens OX=9606 GN=NDUFAF6 PE=1 SV=2
2	AFDB:A2AIL4	0.837	0.837	1.934E-38	333	0.817	0.817	A2AIL4.pdb.gz	NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus OX=10090 GN=Ndufaf6 PE=1 SV=1
3	AFDB:Q9VYS5	0.798	0.795	5.747E-21	334	0.369	0.368	Q9VYS5.pdb.gz	NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster OX=7227 GN=sicily PE=1 SV=1
4	AFDB:B0KZ40	0.749	0.593	5.959E-13	426	0.201	0.157	B0KZ40.pdb.gz	PSY3_MAIZE Phytoene synthase 3, chloroplastic OS=Zea mays OX=4577 GN=PSY3 PE=1 SV=1
5	AFDB:Q2QLV9	0.745	0.630	9.826E-13	398	0.198	0.166	Q2QLV9.pdb.gz	PSY2_ORYSJ Phytoene synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PSY2 PE=1 SV=1
6	AFDB:P37269	0.755	0.812	1.179E-12	308	0.141	0.153	P37269.pdb.gz	CRTB_SYNE7 15-cis-phytoene synthase OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=crtB PE=1 SV=2
7	AFDB:P37294	0.759	0.750	1.695E-12	337	0.153	0.151	P37294.pdb.gz	CRTB_SYNY3 15-cis-phytoene synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=crtB PE=1 SV=1
8	AFDB:P37272	0.751	0.605	3.509E-12	419	0.186	0.148	P37272.pdb.gz	PSY_CAPAN Bifunctional 15-cis-phytoene synthase, chromoplastic OS=Capsicum annuum OX=4072 GN=PSY1 PE=1 SV=1
9	AFDB:P08196	0.754	0.616	4.405E-12	412	0.201	0.163	P08196.pdb.gz	PSY1_SOLLC Phytoene synthase 1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=PSY1 PE=1 SV=2
10	AFDB:Q6ED64	0.749	0.600	4.405E-12	421	0.162	0.128	Q6ED64.pdb.gz	Q6ED64_ORYSI 15-cis-phytoene synthase OS=Oryza sativa subsp. indica OX=39946 PE=2 SV=1
11	PDB:6vkzA	0.267	0.222	2.395E-2	429	0.093	0.072	6vkzA.pdb.gz	Algal neurotoxin biosynthesis repurposes the terpene cyclase structural fold into anN-prenyltransferase.
12	PDB:4la6A	0.435	0.444	2.506E-2	325	0.096	0.098	4la6A.pdb.gz	Unexpected reactivity of 2-fluorolinalyl diphosphate in the active site of crystalline 2-methylisoborneol synthase.
13	PDB:7p5cA	0.117	0.104	2.873E-2	392	0.120	0.102	7p5cA.pdb.gz
14	PDB:6r4vC	0.302	0.334	4.132E-2	294	0.114	0.129	6r4vC.pdb.gz	Metal Coordination Is Crucial for Geranylgeranyl Diphosphate Synthase-Bisphosphonate Interactions: A Crystallographic and Computational Analysis.
15	PDB:3lomA	0.285	0.317	4.325E-2	288	0.117	0.135	3lomA.pdb.gz
16	PDB:2dh4A	0.283	0.285	4.526E-2	326	0.117	0.120	2dh4A.pdb.gz	Crystal Structure of Type-III Geranylgeranyl Pyrophosphate Synthase from Saccharomyces cerevisiae and the Mechanism of Product Chain Length Determination.
17	PDB:4okmA	0.304	0.296	4.736E-2	346	0.123	0.118	4okmA.pdb.gz	Induced-fit mechanism in class i terpene cyclases.
18	PDB:3ts7B	0.253	0.277	4.957E-2	297	0.108	0.121	3ts7B.pdb.gz
19	PDB:7p54A	0.090	0.079	6.511E-2	397	0.111	0.093	7p54A.pdb.gz
20	PDB:1qoyA	0.142	0.151	7.462E-2	303	0.105	0.116	1qoyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AIL4	0.0	572	333	0.820	0.820	NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus OX=10090 GN=Ndufaf6 PE=1 SV=1
2	Q330K2	0.0	695	333	1.000	1.000	NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens OX=9606 GN=NDUFAF6 PE=1 SV=2
3	Q9VYS5	5.31e-65	210	334	0.363	0.362	NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster OX=7227 GN=sicily PE=1 SV=1
4	A0A1D8PJ15	1.04e-17	85.1	380	0.219	0.192	A0A1D8PJ15_CANAL NADH dehydrogenase (Ubiquinone) complex I, assembly factor 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NDU1 PE=4 SV=1
5	B0KZ40	1.94e-08	57.8	426	0.156	0.122	PSY3_MAIZE Phytoene synthase 3, chloroplastic OS=Zea mays OX=4577 GN=PSY3 PE=1 SV=1
6	Q2QLV9	7.05e-07	52.8	398	0.159	0.133	PSY2_ORYSJ Phytoene synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PSY2 PE=1 SV=1
7	B6UV92	1.10e-06	52.4	444	0.144	0.108	PSY3_ORYSJ Phytoene synthase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PSY3 PE=1 SV=1
8	Q6EI12	2.92e-06	50.8	402	0.171	0.142	PSY2_MAIZE Phytoene synthase 2, chloroplastic OS=Zea mays OX=4577 GN=PSY2 PE=1 SV=1
9	Q6ED64	3.19e-06	50.8	421	0.138	0.109	Q6ED64_ORYSI 15-cis-phytoene synthase OS=Oryza sativa subsp. indica OX=39946 PE=2 SV=1
10	Q5Z5B7	3.36e-06	50.8	420	0.138	0.110	PSY1_ORYSJ Phytoene synthase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PSY1 PE=1 SV=1
11	P37272	8.18e-06	49.7	419	0.147	0.117	PSY_CAPAN Bifunctional 15-cis-phytoene synthase, chromoplastic OS=Capsicum annuum OX=4072 GN=PSY1 PE=1 SV=1
12	P37271	1.10e-05	49.3	422	0.141	0.111	PSY_ARATH Phytoene synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSY1 PE=1 SV=2
13	P37269	5.85e-05	46.6	308	0.132	0.143	CRTB_SYNE7 15-cis-phytoene synthase OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=crtB PE=1 SV=2
14	P37294	6.14e-05	46.6	337	0.147	0.145	CRTB_SYNY3 15-cis-phytoene synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=crtB PE=1 SV=1
15	P08196	2.72e-04	44.7	412	0.159	0.129	PSY1_SOLLC Phytoene synthase 1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=PSY1 PE=1 SV=2
16	F4KGX7	0.011	39.7	437	0.144	0.110	F4KGX7_ARATH 15-cis-phytoene synthase OS=Arabidopsis thaliana OX=3702 GN=PSY PE=1 SV=1
17	P54975	0.14	36.2	304	0.066	0.072	CRTB_PARSN 15-cis-phytoene synthase OS=Paracoccus sp. (strain N81106 / MBIC 01143) OX=81397 GN=crtB PE=1 SV=2
18	Q4W8B5	1.5	32.7	310	0.060	0.065	Q4W8B5_9CAUL Phytoene synthase OS=Brevundimonas sp. NBRC 101024 OX=1113698 GN=crtB PE=4 SV=1
19	Q9NR71	3.5	32.0	780	0.093	0.040	ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens OX=9606 GN=ASAH2 PE=1 SV=2
20	Q8AXF4	3.7	32.0	651	0.078	0.040	FBX43_XENLA F-box only protein 43 OS=Xenopus laevis OX=8355 GN=fbxo43 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00494 SQS_PSY	1.9e-55	199.8	Squalene/phytoene synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367346	0.972	Arginine-hydroxylase NDUFAF5, mitochondrial
2	9606.ENSP00000260361	0.912	Complex I intermediate-associated protein 30, mitochondrial
3	9606.ENSP00000002125	0.910	Protein arginine methyltransferase NDUFAF7, mitochondrial
4	9606.ENSP00000358272	0.905	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
5	9606.ENSP00000252711	0.898	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000312618	0.869	Acyl-CoA dehydrogenase family member 9, mitochondrial
7	9606.ENSP00000354687	0.866	NADH-ubiquinone oxidoreductase chain 1
8	9606.ENSP00000323076	0.859	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
9	9606.ENSP00000351737	0.859	Complex I assembly factor TMEM126B, mitochondrial
10	9606.ENSP00000263774	0.858	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
11	9606.ENSP00000356972	0.857	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
12	9606.ENSP00000237889	0.817	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
13	9606.ENSP00000233627	0.816	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
14	9606.ENSP00000389160	0.814	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
15	9606.ENSP00000315774	0.810	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
16	9606.ENSP00000360492	0.806	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
17	9606.ENSP00000263578	0.795	FAD-dependent oxidoreductase domain-containing protein 1
18	9606.ENSP00000252102	0.789	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
19	9606.ENSP00000270517	0.781	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
20	9606.ENSP00000354813	0.756	NADH-ubiquinone oxidoreductase chain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.705	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032981	0.986	mitochondrial respiratory chain complex I assembly
GO:0008152	0.607	metabolic process
GO:0071704	0.358	organic substance metabolic process
GO:0044237	0.311	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.979	membrane
GO:0005634	0.968	nucleus
GO:0031975	0.946	envelope
GO:0031090	0.937	organelle membrane
GO:0031967	0.937	organelle envelope
GO:0031966	0.907	mitochondrial membrane
GO:0005743	0.903	mitochondrial inner membrane
GO:0031974	0.739	membrane-enclosed lumen
GO:0070013	0.582	intracellular organelle lumen
GO:0032991	0.514	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]