StarFunc result for job id Q33E94

User Input

>input (735 residues)
MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPA
TLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLG
TRGQSKYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPE
FPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHML
PVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHD
LPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITK
QTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANEL
MRAMKGEGSTAEVREEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTG
LSTTGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGY
TGSYNYGSYGNQHPHPMQSQYPALPHDTAISGPLHYAPYHRSSAQYPFNSPTSRMEPCLM
SSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSARYGNSSDMYTPLTTRRNSEYEHMQHFP
GFAYINGEASTGWAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q33E94	0.999	0.999	5.501E-93	735	1.000	1.000	Q33E94.pdb.gz	RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2
2	AFDB:A2BGA0	0.673	0.673	3.853E-79	735	0.845	0.845	A2BGA0.pdb.gz	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
3	AFDB:Q5RJA1	0.411	0.361	1.668E-34	848	0.346	0.300	Q5RJA1.pdb.gz	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2
4	AFDB:A0A0B4KFZ2	0.088	0.060	1.406E-3	1161	0.093	0.059	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
5	AFDB:Q9H3S7	0.074	0.042	1.469E-3	1636	0.122	0.055	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
6	AFDB:Q4GYM8	0.081	0.077	1.754E-3	791	0.099	0.092	Q4GYM8.pdb.gz	Q4GYM8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3450 PE=4 SV=1
7	AFDB:Q9C0D6	0.075	0.057	7.922E-3	1143	0.148	0.095	Q9C0D6.pdb.gz	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
8	AFDB:Q304E5	0.075	0.074	1.474E-2	771	0.121	0.115	Q304E5.pdb.gz	Q304E5_CAEEL Guanyl-specific ribonuclease pgl-1 OS=Caenorhabditis elegans OX=6239 GN=pgl-1 PE=1 SV=1
9	AFDB:P53349	0.094	0.062	1.840E-2	1493	0.135	0.066	P53349.pdb.gz	M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3
10	AFDB:A0A0B4LEZ1	0.065	0.044	2.296E-2	1260	0.099	0.058	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
11	PDB:1c7dA	0.181	0.354	6.281E-2	284	0.044	0.113	1c7dA.pdb.gz	Genetically crosslinked hemoglobin: a structural study.
12	PDB:5c05B	0.117	0.148	1.820E-1	522	0.069	0.098	5c05B.pdb.gz
13	PDB:6ikoA	0.071	0.150	3.387E-1	303	0.031	0.076	6ikoA.pdb.gz
14	PDB:6rqxA	0.103	0.092	3.868E-1	862	0.031	0.027	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
15	PDB:5j4nA	0.080	0.120	4.419E-1	437	0.048	0.080	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:7ph3A	0.104	0.125	5.276E-1	577	0.049	0.062	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
17	PDB:4q4aA	0.080	0.096	5.516E-1	572	0.048	0.061	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
18	PDB:7n58A	0.093	0.108	5.516E-1	600	0.064	0.078	7n58A.pdb.gz
19	PDB:7mhyA	0.083	0.115	6.300E-1	491	0.054	0.081	7mhyA.pdb.gz	Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT.
20	PDB:5lzrB	0.093	0.097	6.586E-1	697	0.041	0.043	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BGA0	0.0	1281	735	0.846	0.846	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
2	Q33E94	0.0	1540	735	1.000	1.000	RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2
3	Q7TNK1	0.0	1503	735	0.971	0.971	RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1
4	Q8HWS3	1.26e-143	446	928	0.291	0.231	RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens OX=9606 GN=RFX6 PE=1 SV=2
5	Q8C7R7	3.07e-143	444	927	0.288	0.229	RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus OX=10090 GN=Rfx6 PE=1 SV=2
6	Q5RJA1	3.09e-143	442	848	0.305	0.264	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2
7	P22670	5.94e-89	302	979	0.248	0.186	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
8	P48377	2.29e-88	300	963	0.256	0.195	RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus OX=10090 GN=Rfx1 PE=1 SV=2
9	B2GV50	4.96e-87	290	692	0.230	0.244	RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus OX=10116 GN=Rfx2 PE=1 SV=1
10	Q32NR3	3.33e-86	288	694	0.229	0.242	RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis OX=8355 GN=rfx2 PE=2 SV=1
11	P48378	1.02e-85	288	723	0.234	0.238	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
12	P48380	6.86e-85	286	749	0.224	0.220	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
13	P48381	6.86e-85	286	749	0.224	0.220	RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus OX=10090 GN=Rfx3 PE=1 SV=2
14	Q5EAP5	1.19e-83	282	734	0.245	0.245	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
15	P48379	7.83e-82	277	717	0.226	0.232	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
16	A0A0B4KFL4	7.47e-79	272	882	0.224	0.187	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
17	A0A0B4K621	7.63e-79	272	860	0.226	0.193	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
18	A8JQX0	3.70e-78	271	889	0.227	0.188	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
19	A0A0B4K6P1	4.85e-78	271	911	0.224	0.181	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
20	Q9VGZ6	7.03e-78	270	897	0.227	0.186	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09765 FANCL_d1	2.2e+02	13.2	FANCL UBC-like domain 1
2	PF03288 Pox_D5	0.14	24.0	Poxvirus D5 protein-like
3	PF02257 RFX_DNA_binding	7.7e-31	117.9	RFX DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000040381

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000016444	0.689	Uncharacterized protein
2	9598.ENSPTRP00000027634	0.668	GS homeobox 2
3	9598.ENSPTRP00000029846	0.665	SRY-box 30
4	9598.ENSPTRP00000029401	0.607	Membrane-associated ring finger (C3HC4) 3
5	9598.ENSPTRP00000037748	0.555	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0080090	0.997	regulation of primary metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0006357	0.982	regulation of transcription by RNA polymerase II
GO:0048856	0.972	anatomical structure development
GO:0032501	0.967	multicellular organismal process
GO:0048522	0.953	positive regulation of cellular process
GO:0045944	0.926	positive regulation of transcription by RNA polymerase II
GO:0007275	0.916	multicellular organism development
GO:0007399	0.864	nervous system development
GO:0009987	0.821	cellular process
GO:0007417	0.731	central nervous system development
GO:0048583	0.689	regulation of response to stimulus
GO:0048513	0.657	animal organ development
GO:0030154	0.543	cell differentiation
GO:0021510	0.399	spinal cord development
GO:0071840	0.390	cellular component organization or biogenesis
GO:0016043	0.362	cellular component organization
GO:0003002	0.345	regionalization
GO:0048523	0.343	negative regulation of cellular process
GO:0009966	0.335	regulation of signal transduction
GO:0048585	0.313	negative regulation of response to stimulus
GO:0007420	0.308	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0016020	0.313	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]