StarFunc result for job id Q38SD2

User Input

>input (2015 residues)
MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRA
AYRRGDRGGARDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTD
DNPAVVAAYFGHTAVVQELLESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADP
ESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF
IEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWG
LINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTAS
KNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP
DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRL
QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVL
EFPAFLSESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQL
DTEDLTISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT
GRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY
VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA
LCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG
RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFL
IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG
TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKM
SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKR
NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVCQSEVRDFSAMAFITDHVNSL
IDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDMEDCVLTAIER
DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA
RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIV
ALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKK
NIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV
YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMM
ECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAFFSSQGQEYTVVFWDGKEESR
NYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQQA
LDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVV
CSSEGRGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAAS
HTANPKVPEGDSIADVSIMYSEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLP
SSPASSSSVPFSTDCEDSDMLHTPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW
VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCTFENENTE
WCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q38SD2	1.000	1.000	0.000	2015	1.000	1.000	Q38SD2.pdb.gz	LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=LRRK1 PE=1 SV=3
2	AFDB:Q3UHC2	0.915	0.915	0.000	2014	0.888	0.888	Q3UHC2.pdb.gz	LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Lrrk1 PE=1 SV=1
3	AFDB:Q5S006	0.515	0.416	1.298E-86	2527	0.215	0.172	Q5S006.pdb.gz	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
4	PDB:7lhwA	0.415	0.452	1.908E-65	1813	0.206	0.229	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
5	AFDB:Q8SSS9	0.339	0.432	1.142E-45	1553	0.115	0.149	Q8SSS9.pdb.gz	QKGA_DICDI Probable serine/threonine-protein kinase qkgA OS=Dictyostelium discoideum OX=44689 GN=qkgA-1 PE=3 SV=2
6	PDB:6xr4A	0.376	0.654	3.833E-41	1040	0.129	0.250	6xr4A.pdb.gz
7	AFDB:Q80YE7	0.215	0.290	2.877E-17	1442	0.082	0.115	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
8	AFDB:P42684	0.121	0.200	5.165E-14	1182	0.079	0.135	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
9	PDB:7tvfD	0.117	0.367	6.304E-13	515	0.054	0.212	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
10	PDB:1k9aB	0.129	0.543	1.168E-12	441	0.037	0.170	1k9aB.pdb.gz
11	PDB:4rerA	0.114	0.480	3.645E-12	459	0.034	0.148	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	PDB:8dksA	0.110	0.708	3.645E-12	283	0.038	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:5ufuA	0.119	0.588	4.620E-12	369	0.035	0.192	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:6b1uA	0.115	0.483	5.326E-12	442	0.034	0.156	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:5u6yA	0.118	0.489	6.439E-12	459	0.032	0.142	5u6yA.pdb.gz
16	PDB:2yaaA	0.116	0.707	6.752E-12	300	0.034	0.227	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	AFDB:P15791	0.120	0.431	8.257E-12	533	0.033	0.126	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
18	AFDB:A0A2R8QIR1	0.125	0.450	1.391E-11	523	0.048	0.184	A0A2R8QIR1.pdb.gz
19	AFDB:P08413	0.119	0.416	1.604E-11	542	0.047	0.173	P08413.pdb.gz	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
20	AFDB:A0A2R8PWY6	0.122	0.499	1.682E-11	458	0.033	0.144	A0A2R8PWY6.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q38SD2	0.0	4181	2015	1.000	1.000	LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=LRRK1 PE=1 SV=3
2	Q3UHC2	0.0	3665	2014	0.888	0.889	LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Lrrk1 PE=1 SV=1
3	Q5S006	8.69e-119	422	2527	0.191	0.152	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
4	Q5S007	7.16e-118	419	2527	0.192	0.153	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
5	Q17RV3	7.88e-118	419	2527	0.192	0.153	Q17RV3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=LRRK2 PE=2 SV=1
6	F1LNJ1	1.75e-117	418	2526	0.188	0.150	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
7	Q9TZM3	1.52e-95	348	2393	0.193	0.163	LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=lrk-1 PE=1 SV=6
8	Q55E58	2.65e-82	305	3184	0.167	0.106	PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum OX=44689 GN=pats1 PE=3 SV=1
9	A0A8I6GFN0	1.15e-65	250	2477	0.110	0.089	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
10	Q9VDJ9	5.87e-55	215	2445	0.149	0.123	Q9VDJ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=2 SV=3
11	A0A0B4KH16	7.57e-55	215	2422	0.149	0.124	A0A0B4KH16_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=4 SV=1
12	A0A0B4KHT3	1.03e-54	214	2513	0.149	0.120	A0A0B4KHT3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=4 SV=1
13	Q8MVR1	4.11e-53	209	2631	0.117	0.089	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
14	Q1ZXD6	2.62e-33	144	2800	0.077	0.056	ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum OX=44689 GN=roco5 PE=3 SV=1
15	Q9M085	1.66e-30	128	412	0.047	0.228	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
16	Q9ZQ31	1.28e-27	120	411	0.048	0.234	STY13_ARATH Serine/threonine-protein kinase STY13 OS=Arabidopsis thaliana OX=3702 GN=STY13 PE=1 SV=2
17	Q9Y4C4	3.84e-27	123	1052	0.093	0.179	MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MFHAS1 PE=1 SV=2
18	Q6XHB2	2.44e-26	121	1726	0.054	0.063	ROCO4_DICDI Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum OX=44689 GN=roco4 PE=1 SV=1
19	Q54TM7	1.52e-25	118	1288	0.043	0.067	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1
20	Q3V1N1	5.52e-25	116	1048	0.072	0.139	MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus OX=10090 GN=Mfhas1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.4	19.9	Ankyrin repeat
2	PF12796 Ank_2	2.9e-09	48.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.093	24.2	Ankyrin repeat
4	PF13637 Ank_4	0.029	26.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.8	20.2	Ankyrin repeats (many copies)
6	PF00025 Arf	0.00099	30.1	ADP-ribosylation factor family
7	PF16095 COR	6.8e-21	86.5	C-terminal of Roc, COR, domain
8	PF00560 LRR_1	0.51	21.8	Leucine Rich Repeat
9	PF12799 LRR_4	6.5e-18	75.7	Leucine Rich repeats (2 copies)
10	PF13855 LRR_8	1.4e-22	90.5	Leucine rich repeat
11	PF01926 MMR_HSR1	67	15.0	50S ribosome-binding GTPase
12	PF00069 Pkinase	1.8e-34	130.9	Protein kinase domain
13	PF07714 PK_Tyr_Ser-Thr	1.6e-32	124.4	Protein tyrosine and serine/threonine kinase
14	PF00071 Ras	0.023	25.8	Ras family
15	PF08477 Roc	2.2e-14	65.1	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.848	Growth factor receptor-bound protein 2
2	9606.ENSP00000265062	0.739	Ras-related protein Rab-7a
3	9606.ENSP00000354040	0.732	Nucleolar GTP-binding protein 1
4	9606.ENSP00000364204	0.723	Serine/threonine-protein kinase PINK1, mitochondrial
5	9606.ENSP00000355865	0.722	E3 ubiquitin-protein ligase parkin
6	9606.ENSP00000362314	0.721	Eukaryotic translation initiation factor 4E-binding protein 2
7	9606.ENSP00000298910	0.706	Leucine-rich repeat serine/threonine-protein kinase 2
8	9606.ENSP00000401303	0.705	SHC-transforming protein 1
9	9606.ENSP00000421339	0.699	Solute carrier organic anion transporter family member 6A1
10	9606.ENSP00000361036	0.691	LHFPL tetraspan subfamily member 1
11	9606.ENSP00000299138	0.677	Vacuolar protein sorting-associated protein 35
12	9606.ENSP00000418770	0.651	Protein/nucleic acid deglycase DJ-1
13	9606.ENSP00000481721	0.632	TBC1 domain family member 2A
14	9606.ENSP00000432083	0.627	Heat shock cognate 71 kDa protein
15	9606.ENSP00000241051	0.612	DEP domain containing 7
16	9606.ENSP00000343001	0.596	Ubiquitin conjugation factor E4 B
17	9606.ENSP00000314499	0.584	Cyclin-G-associated kinase
18	9606.ENSP00000368908	0.572	LHFPL tetraspan subfamily member 6 protein
19	9606.ENSP00000426103	0.570	E3 ubiquitin-protein ligase MIB2
20	9606.ENSP00000338814	0.557	BAG family molecular chaperone regulator 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0003824	0.939	catalytic activity
GO:0140096	0.862	catalytic activity, acting on a protein
GO:0019899	0.843	enzyme binding
GO:0042802	0.839	identical protein binding
GO:0016740	0.805	transferase activity
GO:1901363	0.772	heterocyclic compound binding
GO:0097159	0.772	organic cyclic compound binding
GO:0097367	0.725	carbohydrate derivative binding
GO:0035639	0.637	purine ribonucleoside triphosphate binding
GO:0032555	0.606	purine ribonucleotide binding
GO:0016301	0.530	kinase activity
GO:0016773	0.528	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.452	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0048518	0.983	positive regulation of biological process
GO:0009987	0.963	cellular process
GO:0048522	0.960	positive regulation of cellular process
GO:0048584	0.914	positive regulation of response to stimulus
GO:0010647	0.913	positive regulation of cell communication
GO:0009967	0.899	positive regulation of signal transduction
GO:0050896	0.803	response to stimulus
GO:0030111	0.770	regulation of Wnt signaling pathway
GO:0060828	0.706	regulation of canonical Wnt signaling pathway
GO:0019222	0.702	regulation of metabolic process
GO:0008152	0.683	metabolic process
GO:0044237	0.646	cellular metabolic process
GO:0071704	0.645	organic substance metabolic process
GO:0044238	0.635	primary metabolic process
GO:0006807	0.620	nitrogen compound metabolic process
GO:0060255	0.607	regulation of macromolecule metabolic process
GO:0030177	0.595	positive regulation of Wnt signaling pathway
GO:0043170	0.583	macromolecule metabolic process
GO:0031323	0.569	regulation of cellular metabolic process
GO:0019538	0.559	protein metabolic process
GO:0080090	0.537	regulation of primary metabolic process
GO:0051171	0.537	regulation of nitrogen compound metabolic process
GO:0051716	0.503	cellular response to stimulus
GO:0090263	0.503	positive regulation of canonical Wnt signaling pathway
GO:0048519	0.491	negative regulation of biological process
GO:0048523	0.471	negative regulation of cellular process
GO:0007165	0.461	signal transduction
GO:0048856	0.455	anatomical structure development
GO:0032501	0.386	multicellular organismal process
GO:0051246	0.375	regulation of protein metabolic process
GO:0009893	0.355	positive regulation of metabolic process
GO:0036211	0.345	protein modification process
GO:0019220	0.340	regulation of phosphate metabolic process
GO:0031399	0.332	regulation of protein modification process
GO:0010604	0.316	positive regulation of macromolecule metabolic process
GO:0009892	0.314	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.986	mitochondrion
GO:0016020	0.681	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.805	Transferases.
EC:2.7.1.-	0.528	Phosphotransferases with an alcohol group as acceptor.

[back to server]