StarFunc result for job id Q3B7T1

User Input

>input (1238 residues)
MGDAKEAGAEGPPAGAAARGGLSLLSQGESEESSAQGSALFLGGNEVKSRAVVKYSSAPP
RTAFARLEEKTDLKLPPANWLRESAKLGPAGTTILGNSKKSKPFSSFGMAYDFIDSVGND
VDVVSDSENIKKLLKIPYSKSHVSMAVHRIGRTLLLDELDIQELFMRSSQTGDWTWLKEF
YQRLIDQKWQRKKKSKEHWYQKAILSKFLYYSINGDGAAQPVSSTAEQQESSSSDQTNDS
EGASWPAPFEMPSSVSEDPSASSQGSEPLEPSYIVGHVASAPKEQNLITLFNDGEHSQGL
KNDFVRNILWTFEDIHMLVGSNMPIFGGGRYPAVSLRLRDNNKPINVLTGIDYWLDNLIC
NVPELVMCFHVNGIVQKYEMIKTEEIPNLENSNFSTKVIKDIAQNILSFLKSNCTKEGHT
YWLFKASGSDIVKLYDLTTLCEETEDKYQNPFTMPVAILLYKVACNMMMKKNQNKKHYGT
IRTLLLNCLKLLDKSRHPQIIASANYMLSELFQLDEPKKEENSESPLNENSDESYSEEEE
EMPDSDENGSYSTSSDPSDDSKAVAIIKSVGELSVPEKYKSIHQIRPSCAFPVCHDTEER
CRLVLSYVLEGLKSVDSSIKKESDLPAADPSTPIPLKYEDESSRGGPEGLEKQMALFLDK
MGSLQKGNYSSQSGMIPGSWQHKMKLQLILKSSKAYYVLSDAAMSLQKYGRALRYIKLAL
QSHDTYCCLCTNMLSEVLLFLSQYLTLCGDIQLMLAQNANNRAAHLEEFHYQTKEDQEIL
HSLHRESSCQGFAWATDLSTDLESQLSVSCKCYEAANEILQFSDLKSQNPEHYVQVLKRM
GNIRNEIGVFYMNQAAALQSERLVSKSVSAAEQQLWKKSFSCFEKGIHNFESIEDATNAA
LLLCNTGRLMRICAQAHCGAGDELKREFSPEEGLYYNKAIDYYLKALRSLGTRDIHPAVW
DSVNWELSTTYFTMATLQQDYAPLSRKAQEQIEKEVSEAMMKSLKYCDVDSVSARQPLCQ
YRAATIHHRLASMYHSCLRNQVGDEHLRKQHRVLADLHYSKAAKLFQLLKDAPCELLRVQ
LERVAFAEFQMTSQNSNVGKLKTLSGALDIMVRTEHAFQLIQKELIEEFGQPKSGDAAAA
ADASPSLNREEVMKLLSIFESRLSFLLLQSIKLLSSTKKKTSNNIEDDTILKTNKHIYSQ
LLRATANKTATLLERINVIVHLLGQLAAGSAASSNAVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3B7T1	1.000	1.000	0.000	1238	1.000	1.000	Q3B7T1.pdb.gz	EDRF1_HUMAN Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1 PE=1 SV=1
2	PDB:7dkhI	0.096	0.113	1.383E-5	914	0.085	0.115	7dkhI.pdb.gz
3	PDB:7qdrB	0.093	0.089	1.973E-5	1212	0.092	0.094	7qdrB.pdb.gz
4	PDB:6aixA	0.143	0.440	2.222E-5	358	0.041	0.142	6aixA.pdb.gz	Molecular mechanism for the inhibition of DXO by adenosine 3',5'-bisphosphate.
5	PDB:6tedQ	0.103	0.119	5.297E-5	890	0.078	0.109	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
6	AFDB:P89105	0.098	0.107	6.532E-5	1077	0.085	0.097	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
7	PDB:4bujB	0.108	0.103	2.196E-4	1367	0.084	0.076	4bujB.pdb.gz
8	AFDB:A3KDM3	0.118	0.121	2.405E-4	1160	0.086	0.092	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
9	PDB:6wugA	0.144	0.488	3.259E-4	312	0.034	0.135	6wugA.pdb.gz	DXO/Rai1 enzymes remove 5'-end FAD and dephospho-CoA caps on RNAs.
10	AFDB:Q19955	0.142	0.261	5.298E-4	579	0.055	0.117	Q19955.pdb.gz	Q19955_CAEEL Tetratricopeptide repeat protein 28 OS=Caenorhabditis elegans OX=6239 GN=ags-3 PE=1 SV=1
11	PDB:7a09N	0.159	0.383	6.378E-4	447	0.049	0.136	7a09N.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
12	PDB:6yj6A	0.080	0.103	6.902E-4	819	0.072	0.109	6yj6A.pdb.gz
13	PDB:7u6fD1	0.137	0.196	7.470E-4	733	0.073	0.123	7u6fD1.pdb.gz
14	AFDB:A0A0A0MRC4	0.150	0.233	7.560E-4	707	0.055	0.096	A0A0A0MRC4.pdb.gz	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
15	PDB:7n6g1N	0.149	0.093	1.066E-3	2179	0.084	0.048	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
16	AFDB:Q13099	0.096	0.117	3.818E-3	824	0.052	0.078	Q13099.pdb.gz	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
17	AFDB:F4IKX0	0.113	0.122	1.248E-2	1108	0.057	0.064	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
18	AFDB:P14922	0.116	0.136	1.646E-2	966	0.065	0.084	P14922.pdb.gz	CYC8_YEAST General transcriptional corepressor CYC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYC8 PE=1 SV=2
19	AFDB:Q21270	0.094	0.147	3.097E-2	642	0.060	0.115	Q21270.pdb.gz	COG6_CAEEL Conserved oligomeric Golgi complex subunit 6 OS=Caenorhabditis elegans OX=6239 GN=cogc-6 PE=3 SV=1
20	AFDB:Q585L0	0.129	0.208	3.925E-2	605	0.048	0.099	Q585L0.pdb.gz	Q585L0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3B7T1	0.0	2573	1238	1.000	1.000	EDRF1_HUMAN Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1 PE=1 SV=1
2	P09202	0.46	37.0	347	0.016	0.058	F16P_SCHPO Fructose-1,6-bisphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fbp1 PE=3 SV=1
3	Q57XU1	1.9	35.0	696	0.022	0.039	Q57XU1_TRYB2 DUF4139 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.120 PE=4 SV=1
4	F4HXP0	2.3	35.0	651	0.013	0.025	F4HXP0_ARATH ARF GAP-like zinc finger-containing protein ZIGA4 OS=Arabidopsis thaliana OX=3702 GN=ZIGA4 PE=1 SV=1
5	Q84RK2	7.2	33.1	398	0.016	0.050	FAP2_ARATH Fatty-acid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=FAP2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08951 EntA_Immun	1e+03	11.4	Enterocin A Immunity
2	PF07719 TPR_2	1e+02	14.4	Tetratricopeptide repeat
3	PF13181 TPR_8	9.8e+02	11.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438863	0.767	Proton-activated chloride channel that mediates import of chloride ion in response to extracellular acidic pH (PubMed:31023925, PubMed:31318332). Involved in acidosis-induced cell death by mediating chloride influx and subsequent cell swelling (PubMed:31023925, PubMed:31318332)
2	9606.ENSP00000319255	0.683	Cysteine and histidine-rich domain-containing protein 1
3	9606.ENSP00000360329	0.649	Tetratricopeptide repeat domain containing
4	9606.ENSP00000278483	0.621	Protein Hikeshi
5	9606.ENSP00000380153	0.611	Olfactory receptor 51E2
6	9606.ENSP00000357811	0.604	Testis-expressed protein 36
7	9606.ENSP00000287322	0.565	BAG family molecular chaperone regulator 4
8	9606.ENSP00000456401	0.560	Golgin A8 family member J
9	9606.ENSP00000255631	0.549	Hsp70-binding protein 1
10	9606.ENSP00000380159	0.547	FLYWCH family member 2
11	9606.ENSP00000379838	0.544	Calcium-regulated heat-stable protein 1
12	9606.ENSP00000385570	0.503	Islet cell autoantigen 1
13	9606.ENSP00000281474	0.502	Protein bicaudal D homolog 1
14	9606.ENSP00000450958	0.502	Transmembrane protein 179

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0048522	0.927	positive regulation of cellular process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0051173	0.876	positive regulation of nitrogen compound metabolic process
GO:0031325	0.875	positive regulation of cellular metabolic process
GO:0010604	0.872	positive regulation of macromolecule metabolic process
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.752	regulation of macromolecule biosynthetic process
GO:0031326	0.752	regulation of cellular biosynthetic process
GO:0010468	0.746	regulation of gene expression
GO:0009987	0.732	cellular process
GO:0006355	0.730	regulation of DNA-templated transcription
GO:0010557	0.614	positive regulation of macromolecule biosynthetic process
GO:0031328	0.613	positive regulation of cellular biosynthetic process
GO:0045935	0.613	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.590	positive regulation of RNA biosynthetic process
GO:0045893	0.569	positive regulation of DNA-templated transcription
GO:0050896	0.342	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005654	0.983	nucleoplasm
GO:0016020	0.662	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]