StarFunc result for job id Q3B8N2

User Input

>input (356 residues)
MAFSGSQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQKGRWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSK
SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3B8N2	1.000	1.000	1.841E-65	356	1.000	1.000	Q3B8N2.pdb.gz	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
2	AFDB:A0A024QZ02	0.832	0.915	2.568E-57	323	0.860	0.947	A0A024QZ02.pdb.gz
3	AFDB:O08573	0.787	0.793	3.698E-52	353	0.685	0.691	O08573.pdb.gz	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	AFDB:P97840	0.469	0.471	2.787E-51	354	0.705	0.709	P97840.pdb.gz	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	AFDB:P56470	0.593	0.644	7.283E-34	323	0.368	0.406	P56470.pdb.gz	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
6	AFDB:J3QR96	0.544	0.782	3.920E-33	246	0.615	0.890	J3QR96.pdb.gz	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
7	AFDB:Q8K419	0.579	0.622	4.315E-33	326	0.365	0.399	Q8K419.pdb.gz	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
8	AFDB:O00214	0.402	0.450	1.191E-31	317	0.312	0.350	O00214.pdb.gz	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
9	AFDB:Q9JL15	0.391	0.440	2.571E-31	316	0.309	0.348	Q9JL15.pdb.gz	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
10	AFDB:O54891	0.578	0.663	5.290E-31	301	0.354	0.419	O54891.pdb.gz	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
11	PDB:6m5yA	0.341	0.444	7.536E-19	270	0.205	0.270	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:3vv1A	0.366	0.902	9.003E-13	141	0.110	0.277	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
13	PDB:3zxfB	0.351	0.888	3.143E-12	138	0.146	0.377	3zxfB.pdb.gz
14	PDB:6ljqA	0.363	0.894	2.736E-11	140	0.129	0.329	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
15	PDB:5xg7A	0.360	0.889	7.158E-11	139	0.118	0.302	5xg7A.pdb.gz
16	PDB:6l6aA	0.361	0.877	8.677E-11	142	0.115	0.289	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
17	PDB:1w6mA	0.340	0.863	6.861E-10	134	0.112	0.299	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
18	PDB:6k2zA	0.304	0.747	1.883E-9	138	0.118	0.304	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
19	PDB:4ga9A	0.345	0.872	2.073E-9	134	0.093	0.246	4ga9A.pdb.gz	Gal-1 structure analysis
20	PDB:5dg2B	0.321	0.843	2.767E-9	131	0.090	0.244	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KSY2	0.0	639	323	0.899	0.991	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
2	O00182	0.0	693	355	0.949	0.952	LEG9_HUMAN Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2
3	O08573	0.0	506	353	0.685	0.691	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	P97840	0.0	519	354	0.705	0.709	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	Q3B8N2	0.0	733	356	1.000	1.000	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
6	Q6DKI2	0.0	725	356	0.989	0.989	LEG9C_HUMAN Galectin-9C OS=Homo sapiens OX=9606 GN=LGALS9C PE=1 SV=2
7	J3QR96	2.01e-149	422	246	0.612	0.886	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
8	J3KT17	1.15e-138	395	234	0.579	0.880	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
9	J3QSH0	3.73e-102	300	175	0.407	0.829	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
10	J3KS82	2.21e-99	293	175	0.396	0.806	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
11	Q8K419	2.58e-64	209	326	0.368	0.402	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
12	P56470	1.99e-61	201	323	0.354	0.390	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
13	O54891	1.41e-57	191	301	0.351	0.415	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
14	Q9JL15	1.61e-54	183	316	0.315	0.354	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
15	O00214	1.83e-53	181	317	0.315	0.353	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
16	Q91VD1	5.27e-32	124	314	0.272	0.309	LEG12_MOUSE Galectin-12 OS=Mus musculus OX=10090 GN=Lgals12 PE=1 SV=2
17	Q96DT0	2.45e-30	120	336	0.278	0.295	LEG12_HUMAN Galectin-12 OS=Homo sapiens OX=9606 GN=LGALS12 PE=1 SV=1
18	P16110	2.44e-29	115	264	0.185	0.250	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
19	Q6NVH9	7.00e-28	111	250	0.199	0.284	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
20	A0A024R693	7.37e-28	111	250	0.163	0.232	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	4.6e-72	251.3	Galactoside-binding lectin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315564

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428489	0.878	Lymphokine-activated killer T-cell-originated protein kinase
2	9606.ENSP00000312002	0.739	Hepatitis A virus cellular receptor 2
3	9606.ENSP00000378856	0.705	Galectin-9
4	9606.ENSP00000328054	0.685	Putative coiled-coil domain-containing protein 144 N-terminal-like
5	9606.ENSP00000398632	0.629	CD44 antigen
6	9606.ENSP00000378887	0.610	Dehydrogenase/reductase SDR family member 7B
7	9606.ENSP00000411355	0.566	Receptor-type tyrosine-protein phosphatase C
8	9606.ENSP00000341787	0.524	Butyrophilin-like protein 3
9	9606.ENSP00000250974	0.504	Protein ABHD17A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.915	carbohydrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0002684	0.992	positive regulation of immune system process
GO:0050794	0.984	regulation of cellular process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0051049	0.981	regulation of transport
GO:0050896	0.980	response to stimulus
GO:0080090	0.977	regulation of primary metabolic process
GO:0032501	0.976	multicellular organismal process
GO:0048584	0.973	positive regulation of response to stimulus
GO:0051246	0.972	regulation of protein metabolic process
GO:0002376	0.971	immune system process
GO:0050776	0.968	regulation of immune response
GO:0048523	0.968	negative regulation of cellular process
GO:0051051	0.966	negative regulation of transport
GO:0048585	0.965	negative regulation of response to stimulus
GO:0060627	0.963	regulation of vesicle-mediated transport
GO:0032103	0.961	positive regulation of response to external stimulus
GO:0050778	0.957	positive regulation of immune response
GO:0050863	0.956	regulation of T cell activation
GO:0009892	0.955	negative regulation of metabolic process
GO:1903037	0.953	regulation of leukocyte cell-cell adhesion
GO:0001817	0.953	regulation of cytokine production
GO:0002695	0.953	negative regulation of leukocyte activation
GO:0031347	0.952	regulation of defense response
GO:1903530	0.952	regulation of secretion by cell
GO:0007162	0.952	negative regulation of cell adhesion
GO:0002697	0.943	regulation of immune effector process
GO:0008285	0.941	negative regulation of cell population proliferation
GO:0002831	0.937	regulation of response to biotic stimulus
GO:0010605	0.935	negative regulation of macromolecule metabolic process
GO:1903039	0.935	positive regulation of leukocyte cell-cell adhesion
GO:1903555	0.932	regulation of tumor necrosis factor superfamily cytokine production
GO:0051251	0.932	positive regulation of lymphocyte activation
GO:0001819	0.927	positive regulation of cytokine production
GO:0023051	0.925	regulation of signaling
GO:0010646	0.925	regulation of cell communication
GO:0032944	0.925	regulation of mononuclear cell proliferation
GO:0051716	0.922	cellular response to stimulus
GO:0030334	0.922	regulation of cell migration
GO:0050870	0.920	positive regulation of T cell activation
GO:0050868	0.919	negative regulation of T cell activation
GO:0009966	0.917	regulation of signal transduction
GO:0050790	0.916	regulation of catalytic activity
GO:0002698	0.916	negative regulation of immune effector process
GO:0045088	0.914	regulation of innate immune response
GO:0050670	0.914	regulation of lymphocyte proliferation
GO:0031323	0.913	regulation of cellular metabolic process
GO:0030335	0.909	positive regulation of cell migration
GO:0007165	0.904	signal transduction
GO:0032680	0.901	regulation of tumor necrosis factor production
GO:0044419	0.898	biological process involved in interspecies interaction between organisms
GO:0051707	0.891	response to other organism
GO:0010720	0.891	positive regulation of cell development
GO:1903708	0.881	positive regulation of hemopoiesis
GO:0031341	0.880	regulation of cell killing
GO:1902105	0.878	regulation of leukocyte differentiation
GO:0022414	0.863	reproductive process
GO:0010629	0.850	negative regulation of gene expression
GO:0009615	0.840	response to virus
GO:0044093	0.835	positive regulation of molecular function
GO:0010033	0.825	response to organic substance
GO:0050777	0.818	negative regulation of immune response
GO:0032945	0.815	negative regulation of mononuclear cell proliferation
GO:0009967	0.806	positive regulation of signal transduction
GO:0006952	0.778	defense response
GO:0042129	0.771	regulation of T cell proliferation
GO:0071677	0.750	positive regulation of mononuclear cell migration
GO:0048856	0.733	anatomical structure development
GO:0001910	0.729	regulation of leukocyte mediated cytotoxicity
GO:0002704	0.727	negative regulation of leukocyte mediated immunity
GO:0002715	0.727	regulation of natural killer cell mediated immunity
GO:0070887	0.710	cellular response to chemical stimulus
GO:0051173	0.696	positive regulation of nitrogen compound metabolic process
GO:0006355	0.663	regulation of DNA-templated transcription
GO:0008152	0.619	metabolic process
GO:0007275	0.587	multicellular organism development
GO:0071704	0.543	organic substance metabolic process
GO:0051247	0.536	positive regulation of protein metabolic process
GO:0042981	0.494	regulation of apoptotic process
GO:0048731	0.486	system development
GO:0098586	0.474	cellular response to virus
GO:0044237	0.445	cellular metabolic process
GO:0009617	0.409	response to bacterium
GO:0044092	0.400	negative regulation of molecular function
GO:0031349	0.398	positive regulation of defense response
GO:0045089	0.390	positive regulation of innate immune response
GO:0002520	0.379	immune system development
GO:0006807	0.356	nitrogen compound metabolic process
GO:0098542	0.352	defense response to other organism
GO:0043170	0.331	macromolecule metabolic process
GO:0006955	0.301	immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.822	intracellular membrane-bounded organelle
GO:0071944	0.576	cell periphery
GO:0005634	0.346	nucleus
GO:0005576	0.304	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]