StarFunc result for job id Q3B8N5

User Input

>input (592 residues)
MDPNSILLSPQPQICSHLAEACTEGERSSSPPELDRDSPFPWSQVPSSSPTDPEWFGDEH
IQAKRARVETIVRGMCLSPNPLVPGNAQAGVSPRCPKKARERKRKQNLPTPQGLLMPAPA
WDQGNRKGGPRVREQLHLLKQQLRHLQEHILQAAKPRDTAQGPGGCGTGKGPLSAKQGNG
CGPRPWVVDGDHQQGTSKDLSGAEKHQESEKPSFLPSGAPASLEILRKELTRAVSQAVDS
VLQKVLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPV
GNLSLAKRLDSPRYPIPPRMTPKPCQDPPANFPLTAPSHIQENQILSQLLGHRYNNGHWS
SSPPQDSSSQRHPSSEPALRPWRTTKPQPLVLSQQQCPLPFTSAHLESLPLLPSVKMEQR
GLHAVMEALPFSLLHIQEGLNPGHLKKAKLMFFFTRYPSSNLLKVYFPDVQFNRCITSQM
IKWFSNFREFYYIQMEKSARQAISDGVTNPKMLVVLRNSELFQALNMHYNKGNDFEVPDC
FLEIASLTLQEFFRAVSAGRDSDPSWKKPIYKIISKLDSDIPEIFKSSSYPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CAZ0	0.087	0.055	8.167E-4	1179	0.133	0.067	P0CAZ0.pdb.gz	TTL3B_TETTS Tubulin glycylase 3B OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTLL3B PE=1 SV=2
2	AFDB:F1NPG5	0.109	0.102	5.521E-2	639	0.122	0.113	F1NPG5.pdb.gz	CENPT_CHICK Centromere protein T OS=Gallus gallus OX=9031 GN=CENPT PE=1 SV=2
3	AFDB:Q9UL49	0.063	0.070	7.604E-2	500	0.130	0.154	Q9UL49.pdb.gz	TCFL5_HUMAN Transcription factor-like 5 protein OS=Homo sapiens OX=9606 GN=TCFL5 PE=2 SV=2
4	AFDB:Q96BT3	0.087	0.091	1.105E-1	561	0.145	0.153	Q96BT3.pdb.gz	CENPT_HUMAN Centromere protein T OS=Homo sapiens OX=9606 GN=CENPT PE=1 SV=2
5	AFDB:Q8T867	0.057	0.049	1.165E-1	730	0.103	0.084	Q8T867.pdb.gz	Q8T867_DICDI DNAJ heat shock N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276447 PE=4 SV=1
6	AFDB:Q700D7	0.084	0.097	1.521E-1	499	0.084	0.100	Q700D7.pdb.gz	Q700D7_ARATH At4g12670 OS=Arabidopsis thaliana OX=3702 GN=At4g12670 PE=1 SV=1
7	AFDB:Q8INQ6	0.074	0.053	2.458E-1	904	0.150	0.098	Q8INQ6.pdb.gz	Q8INQ6_DROME 5-hydroxytryptamine (Serotonin) receptor 2B, isoform D OS=Drosophila melanogaster OX=7227 GN=5-HT2B PE=2 SV=2
8	AFDB:M9MRE4	0.081	0.048	2.735E-1	1426	0.139	0.058	M9MRE4.pdb.gz	M9MRE4_DROME Dachs, isoform E OS=Drosophila melanogaster OX=7227 GN=dachs PE=3 SV=1
9	AFDB:Q62187	0.084	0.064	2.735E-1	859	0.147	0.101	Q62187.pdb.gz	TTF1_MOUSE Transcription termination factor 1 OS=Mus musculus OX=10090 GN=Ttf1 PE=1 SV=2
10	AFDB:C8VUD1	0.051	0.059	3.043E-1	492	0.117	0.140	C8VUD1.pdb.gz	C8VUD1_EMENI C2H2 finger domain transcription factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00273 PE=4 SV=1
11	PDB:1jr3D	0.108	0.167	1.717	338	0.035	0.062	1jr3D.pdb.gz	Crystal structure of the processivity clamp loader gamma (gamma) complex of E. coli DNA polymerase III.
12	PDB:2yv9A	0.083	0.136	1.911	285	0.032	0.067	2yv9A.pdb.gz	Comparison of vertebrate and invertebrate CLIC proteins: The crystal structures of Caenorhabditis elegans EXC-4 and Drosophila melanogaster DmCLIC
13	PDB:3r2qA	0.064	0.148	2.126	202	0.030	0.089	3r2qA.pdb.gz	Structural and Functional Genomics of YibF, a Glutathione Transferase Homologue from Escherichia coli
14	PDB:2k7wA	0.097	0.222	2.365	192	0.022	0.068	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
15	PDB:7wffh	0.084	0.253	2.365	145	0.025	0.103	7wffh.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
16	PDB:3dhrA	0.075	0.212	2.631	141	0.034	0.142	3dhrA.pdb.gz	Purification, Crystallization and X-ray Diffraction Studies of Pigeon Hemoglobin
17	PDB:1wu3I	0.084	0.205	3.088	161	0.025	0.093	1wu3I.pdb.gz
18	PDB:3hf4F	0.099	0.222	3.257	146	0.027	0.110	3hf4F.pdb.gz	Quaternary structural variability in rat hemoglobin
19	PDB:1c1kA	0.095	0.177	3.624	217	0.024	0.065	1c1kA.pdb.gz
20	PDB:4hm9A	0.066	0.072	3.822	511	0.024	0.027	4hm9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91018	1.36e-97	315	736	0.397	0.319	PROX1_CHICK Prospero homeobox protein 1 OS=Gallus gallus OX=9031 GN=PROX1 PE=2 SV=1
2	Q92786	4.86e-97	314	737	0.395	0.318	PROX1_HUMAN Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2
3	P48437	4.45e-78	263	737	0.201	0.161	PROX1_MOUSE Prospero homeobox protein 1 OS=Mus musculus OX=10090 GN=Prox1 PE=1 SV=2
4	D3ZU00	4.78e-78	263	737	0.201	0.161	D3ZU00_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=3
5	Q90ZL7	6.85e-78	263	739	0.204	0.164	Q90ZL7_DANRE Prospero homeobox protein 1 OS=Danio rerio OX=7955 GN=zgc:111888 PE=2 SV=1
6	F1QAE1	6.99e-78	263	739	0.204	0.164	F1QAE1_DANRE Prospero homeobox 1a OS=Danio rerio OX=7955 GN=prox1 PE=4 SV=1
7	D2DHG1	5.24e-62	218	659	0.167	0.150	D2DHG1_DANRE Prospero homeobox 3 OS=Danio rerio OX=7955 GN=prox1b PE=2 SV=1
8	P29617	6.70e-57	209	1703	0.147	0.051	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
9	P34522	1.48e-53	194	594	0.140	0.140	PROS1_CAEEL Homeobox protein prospero homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pros-1 PE=2 SV=2
10	A0A8I6A8R7	1.74e-51	189	628	0.142	0.134	A0A8I6A8R7_RAT Prospero homeobox 1 OS=Rattus norvegicus OX=10116 GN=Prox1 PE=1 SV=1
11	C9JU29	3.53e-09	59.7	230	0.073	0.187	C9JU29_HUMAN Prospero homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=1
12	P76129	1.8	33.9	799	0.039	0.029	DOSP_ECOLI Oxygen sensor protein DosP OS=Escherichia coli (strain K12) OX=83333 GN=dosP PE=1 SV=4
13	Q35303	7.1	30.4	123	0.041	0.195	Q35303_ORYSJ ORF123 OS=Oryza sativa subsp. japonica OX=39947 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05044 HPD	2.9e-78	272.5	Homeo-prospero domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256362	0.689	Vertnin
2	9606.ENSP00000306410	0.613	Armadillo repeat-containing protein 4
3	9606.ENSP00000358807	0.556	Homeobox protein aristaless-like 3
4	9606.ENSP00000368872	0.546	Protein inscuteable homolog
5	9606.ENSP00000258774	0.533	Checkpoint protein HUS1
6	9606.ENSP00000370293	0.533	Checkpoint protein HUS1B
7	9606.ENSP00000295454	0.510	Gamma-aminobutyric acid receptor subunit beta-1
8	9606.ENSP00000364946	0.504	Homeobox protein Mohawk
9	9606.ENSP00000261304	0.501	Galactocerebrosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.811	heterocyclic compound binding
GO:0097159	0.807	organic cyclic compound binding
GO:0003676	0.772	nucleic acid binding
GO:0003677	0.610	DNA binding
GO:0043565	0.594	sequence-specific DNA binding
GO:1990837	0.422	sequence-specific double-stranded DNA binding
GO:0001067	0.366	transcription regulatory region nucleic acid binding
GO:0003700	0.362	DNA-binding transcription factor activity
GO:0000976	0.353	transcription cis-regulatory region binding
GO:0000981	0.325	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0065007	0.968	biological regulation
GO:0032502	0.953	developmental process
GO:0050789	0.921	regulation of biological process
GO:0050794	0.900	regulation of cellular process
GO:0032501	0.840	multicellular organismal process
GO:0008152	0.663	metabolic process
GO:0048856	0.570	anatomical structure development
GO:0071704	0.566	organic substance metabolic process
GO:0044238	0.488	primary metabolic process
GO:0006807	0.458	nitrogen compound metabolic process
GO:0044237	0.456	cellular metabolic process
GO:0007275	0.456	multicellular organism development
GO:0019222	0.405	regulation of metabolic process
GO:0048519	0.368	negative regulation of biological process
GO:0051171	0.339	regulation of nitrogen compound metabolic process
GO:0000003	0.335	reproduction
GO:0048523	0.320	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0005737	0.765	cytoplasm
GO:0043232	0.352	intracellular non-membrane-bounded organelle
GO:0032991	0.304	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]